Annotation Для того, чтобы посмотреть, как развивается зародыш, Клеопатра приказывала вспарывать животы беременным рабыням. Сегодня мы знаем о механизмах


НазваниеAnnotation Для того, чтобы посмотреть, как развивается зародыш, Клеопатра приказывала вспарывать животы беременным рабыням. Сегодня мы знаем о механизмах
Дата публикации17.06.2013
Размер3.81 Mb.
ТипДокументы
userdocs.ru > География > Документы
Annotation Для того, чтобы посмотреть, как развивается зародыш, Клеопатра приказывала вспарывать животы беременным рабыням. Сегодня мы знаем о механизмах, которые заставляют одну-единственную клетку превращаться сначала в эмбрион, после – в ребенка, а затем и во взрослого человека, несравненно больше, чем во времена жестокой египтянки, однако многие вопросы по-прежнему остаются без ответов. Один из основных методов исследовать пути формирования человеческого тела – это проследить за возникающими в этом процессе сбоями или, как говорят ученые, мутациями. Именно об этих "неполадках", приводящих к появлению сиамских близнецов, двухголовых ягнят и прочих мутантов, рассказывает в своей увлекательной и порой шокирующей книге британский биолог Арман Мари Леруа. Используя истории знаменитых "уродцев" в качестве отправной точки для своих рассуждений, автор подводит читателя к пониманию сложных законов, позволяющих человеческим телу на протяжении многих поколений сохранять относительную стабильность, оставаясь при этом поразительно многообразным. УДК 575-2 ББК 28.704 ISBN 978-5-271-24665-4 (ООО "Издательство Астрель") © Armand Marie Leroi, 2003 © Фонд Дмитрия Зимина "Династия", российское издание, 2009 © Е. Година, перевод на русский язык, 2009 © А. Бондаренко, оформление, 2009 Фонд некоммерческих программ "Династия" основан В 2002 году Дмитрием Борисовичем Зиминым, почетным президентом компании "Вымпелком". Приоритетные направления деятельности Фонда – развитие фундаментальной науки и образования в России, популяризация науки и просвещение. В рамках программы по популяризации науки Фондом запущено несколько проектов. В их числе – сайт elementy.ru, ставший одним из ведущих в русскоязычном Интернете тематических ресурсов, а также проект "Библиотека "Династии" – издание современных научно-популярных книг, тщательно отобранных экспертами-учеными. Книга, которую вы держите в руках, выпущена в рамках этого проекта. Более подробную информацию о Фонде "Династия" вы найдете по адресу: WWW.DYNASTYFDN.RU * * * Пролог Глава I Глава II Апофеоз Риты-Кристины Пара напольных часов Как получить сросшихся близнецов Сформируйте меня E pluribus unum?[32] Соединенность Правое – левое Глава IIIЦиклопия Циклопы Сирены Калькулятор судьбы Три тысячи переключений Mutatis mutandis[85] Глава IV Использование конечностей Ближе – дальше Стремление к десятичности Кисти, стопы и предки Глава V Формирование костей Как растут кости Освенцим, 1944 Тормоза Обновление Глава VI Совершенство пропорций Пигмеи Кретины Il coltello[186] Что значит быть нормального роста Глава VII Гениталии Пятьдесят на пятьдесят Если Гиены Объект желания Глава VIII Женевьева Палитра "Пегие" (частичный альбинизм) Динка или голландцы История Петруса Гонсальвуса и Схве Маонга Топография волос Земля без колосьев Под покровом голой обезьяны Артемида Эфесская Глава IX Бессилие отбора Геронтократы La vita sobria[278] Дыхание смерти Морщины Жить до ста Только вверх Глава X Благодарности P.S. Размышления, интервью, рекомендации... [об авторе] [о книге] Библиография notes 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 Арман Мари Леруа * * * Пролог Мой ум стремится описать тела, Которые приобрели иные формы. Овидий. Метаморфозы Эта книга рассказывает о том, как создается человеческое тело. О приемах, которые позволяют одной-единственной клетке, погруженной в темные закоулки чрева, стать эмбрионом, плодом, ребенком и, наконец, взрослым. Она дает ответ, хотя и предварительный и неполный, но все же четкий в своей основе, на вопрос: как мы становимся тем, что мы есть. Отчасти ответ на этот вопрос довольно очевиден. Наши тела – и я не без колебаний добавляю, наши души – являются продуктами наших генов. По крайней мере, наши гены содержат ту информацию – можно сказать – техническую инструкцию, которая позволяет эмбриональным клеткам превращаться в различные части нашего тела. Но этот ответ, с виду такой простой, скрывает за собой целый мир, о котором нам мало что известно. Генетика, по словам одного популярного автора, пишущего на подобные темы, – это язык. "У него есть свой словарь – сами гены, грамматика – способ организации наследственной информации и литература – тысячи инструкций, необходимых для создания человеческого существа". Все это так. Но об одном он забыл упомянуть: язык генов в основном нам недоступен. Пятнадцатого февраля 2001 года международный консорциум ученых сообщил о полном или почти полном секвенировании генома человека. У нас, как нам сообщили, имеется около 30 тысяч генов. Вот она – представленная нашим взорам техническая инструкция по созданию человека. Ее может прочитать любой, найдя в свободном доступе в Интернете. Но советую не торопиться. Средний англичанин может с таким же успехом попытаться прочесть в оригинале "Аналекты" Конфуция, дабы прильнуть к их неисчерпаемой мудрости. Даже генетики пребывают в затруднении относительно большей части содержания генома. При его просмотре то там, то здесь им попадаются слова с довольно понятным значением. О смысле других слов можно догадаться, потому что они тесно связаны с хорошо знакомыми. Некоторые грамматические закономерности, синтаксические правила, посредством которых гены объединяются, чтобы придать смысл своим высказываниям, также понятны. Но синтаксис генов намного сложнее, тоньше и разнообразнее, чем в любом из языков, на котором говорят люди. И хотя теперь эта область уже не является для нас закрытой книгой, все-таки мы лишь начинаем ее читать. И дело не в том, что мы не знаем, как расшифровать геном. В книге много описаний экспериментов, целью которых как раз это и является. Такие эксперименты обычно связаны с инженерией эмбрионов – либо путем хирургического добавления или удаления органов, либо с помощью добавления или удаления генов. Конечно, эмбрионы всегда принадлежат животным: тритонам, лягушкам, курам или мышам. Они довольно много рассказывают нам о нас самих, поскольку так уж случилось, что генетическая грамматика всех живых существ весьма сходна. Но наподобие того как с течением времени словарный запас и грамматические правила человеческих языков в большей или меньшей степени отдалились друг от друга, так же изменились и языки генов. Учиться только у животных значит впасть в риск ошибиться, вроде того, как это случилось с Леонардо да Винчи, когда он нарисовал человеческий плод, прикрепленный к тому, что, безусловно, являло собой плаценту коровы. Нам нужны, наконец, некие прямые пути, ведущие к геному человека и к человеческому телу. Клеопатра, по утверждению одного исторического источника, приказывала вскрывать животы беременным рабыням, дабы наблюдать за развитием зародышей. Отдавая должное ее любознательности и умению в напряженном ритме общественных обязательств найти время для лабораторной работы, мы едва ли можем последовать ее примеру. Мы должны найти более осторожные пути изучения человеческого тела. Мы должны найти мутантов. Глава I Мутанты [вступление] Фронтиспис книги Фортунио Лицети "О происхождении, природе и разновидностях уродов", 1634 (Библиотека Уэллком, Лондон). Мы узнали, что в Равенне родилось чудовище, изображение которого прислали сюда: на голове у него торчит рог – прямой, как меч, вместо рук – два крыла, как у летучей мыши, на уровне груди с одной стороны рубец в виде буквы У, с другой – крест, а ниже, у талии, – две змеи. Это гермафродит, на правом колене у него глаз, а левая ступня – как у орла. Я видел, как его рисовали, и всякий, кто пожелает, может посмотреть на этот рисунок во Флоренции.[1] Так писал в своем дневнике флорентийский аптекарь по имени Лука Ландуччи. Шел март 1512 года, и у Ландуччи было о чем поведать. Северная Италия объята войной. Максимилиан, император германский, и Людовик XII, король французский, захвачены борьбой с испанцами, англичанами и папой Юлием II за контроль над Венецианской республикой. Разоряя город за городом, армии бороздят страну. Равенна пала через восемнадцать дней после рождения чудовища. "Стало ясно, – писал Ландуччи, – какое зло принес им этот монстр! Как будто великие несчастья всегда обрушиваются на город, когда рождаются такие существа". Ландуччи в действительности никогда не видел монстра. Того уморили голодом по приказу Юлия II, и рассказ Ландуччи основан на зарисовке, выставленной на публичное обозрение во Флоренции. Это изображение было первым из многих, последовавших за ним. Оттиски и гравюры разнесли весть о чудовище по всей Европе, и по мере их распространения монстр обретал новую, посмертную жизнь. Покидая Равенну, он стоял на двух ногах, но, прибыв в Париж, остался при одной. На некоторых оттисках у него крылья летучей мыши, на других – они больше похожи на птичьи. Его изображали то с гениталиями гермафродита, то с одним большим эрегированным членом. Постепенно его стали путать с другим монстром, родившимся во Флоренции в 1506 году, чей образ впоследствии попал на средневековую икону, изображавшую греховность человеческого рода. Это была так называемая "Фрау Вельт" ("Госпожа Земли") – одноногая гарпия с крыльями, словно у летучей мыши, схватившая Землю своими когтями. Равеннский монстр, 1512 г. Из книги Улиссе Альдрованди "История монстров", 1642 (Библиотека Уэллком, Лондон). По мере того как монстр странствовал и видоизменялся, легенда о нем обретала все более сложные оттенки и скрытые смыслы. Итальянцы усмотрели в нем предупреждение против ужасов войны. Французы, затратив больше аналитических усилий, истолковали рог как символ гордыни, крылья – как проявление легкомыслия и непостоянства, отсутствие рук – как недостаток добрых дел, ступню хищной птицы – как признак ненасытности, уродливые половые органы – как результат содомии, перечислив, иначе говоря, все известные итальянские пороки. По словам одних, монстр родился у почтенной замужней женщины; другие утверждали, что это был плод греховной связи между монахиней и монахом. Под бременем аллегорий трудно распознать, кем же в действительности был монстр. Вероятнее всего, это был просто ребенок, родившийся с тяжелым, редким, но отнюдь не загадочным генетическим расстройством. Можно даже рискнуть высказать предположение о том, что у него был синдром Робертса – уродство, встречающееся у детей, родившихся с исключительно вредоносной мутацией. Это, по крайней мере, объясняет аномалии конечностей и половых органов, а также, возможно, появление двух змей на талии и лишнего глаза на колене. Синдром Робертса. Мертворожденный младенец. Из книги Б.К. Херста и Дж.А. Пирсона "Человеческие уродства", 1893 (Библиотека Уэллком, Лондон). В XVI и XVII веках уроды встречались повсюду. Правители коллекционировали их, натуралисты каталогизировали, теологи использовали для религиозной пропаганды. Ученые мужи рисовали карты их распространения и включали пассажи об их значении в изысканно иллюстрированные книги. В Германии Конрад Ликосфен произвел на свет труд "Книга о чудесах и знамениях" (1557 год; позднее эта книга была переведена на английский язык под названием "Ужасы, зовущие людей на Страшный суд"); во Франции вышли книги Пьера Боэстюо "Чудесные истории" (1560-1582) и Амбруаза Паре "О монстрах и диковинках" (1573). Чуть позже итальянцы ответили книгами Фортунио Лицети "О происхождении, природе и разновидностях уродов" (1616) и Улиссе Альдрованди "История монстров" (1642). В эпоху, когда религиозные чувства были крайне выражены, уродство часто воспринималось как знак божественного недовольства или, по меньшей мере, предвестие какого-нибудь неприятного события в ближайшем будущем. "Чудесные истории" Боэстюо, особенно изобилующие демоническими созданиями, содержат прекрасное описание не только несчастного Равеннского монстра, но также и Краковского монстра – непостижимо изуродованного ребенка, который, по-видимому, появился на свет в 1540 году с головами лающих псов на локтях, груди и коленях и покинул его четыре часа спустя, провозгласив: "Виждите, Всевышний идет". Аллегория была тем состязанием, в котором преуспевали протестантские схоласты. В 1523 году Мартин Лютер и Филипп Меланхтон опубликовали памфлет, где описывались родившийся во Фрейбурге урод, "полумонах-полутеленок", и другое существо, возможно – человеческой природы, выловленное в реке Тибр. Оба они интерпретировались авторами в весьма едких выражениях как символы упадка римской церкви. Католики ответили на вызов, идентифицировав теленка с Лютером. В конце XVI века объяснения становятся более наукообразными. В книге "О монстрах", этом занимательно эклектичном компендиуме чудес природы, парижский хирург Амбруаз Паре перечислил возможные причины уродств. Под первым номером значился "гнев Божий". Однако распространялся он в основном на людей, которые занимались сексом с животными (производя тем самым на свет помесь человека с лошадьми / козами / собаками / овцами) или имели любовные отношения с менструирующими женщинами (что осуждалось Третьей книгой Моисеевой Левит). Лютеровский "полумонах-полутеленок" также фигурирует в "Монстрах", но без антипапских обличий. Вместо этого он представлен как монстр "воображения", то есть появившийся под влиянием материнских впечатлений. Эта точка зрения, преобладавшая во времена Паре и сохранившаяся вплоть до конца XIX века, состояла в том, что беременная женщина, глядя на безобразные вещи, может вызвать уродство в собственном ребенке. Подобно большинству других объяснений, которые перечисляет Паре в качестве причины уродств (слишком много или слишком мало семени, узкая матка, непристойная поза), теория материнских впечатлений попросту неверна. Но ее, по крайней мере, можно назвать рациональной – в том смысле, что она не включает сверхъестественные силы. Тем самым в "Монстрах" высказывается новая идея: причины уродств следует искать в природе.[2] В начале XVII века тератология – буквально "наука об уродах" – начинает выходить за пределы средневекового мира чудес. Посмертно опубликованная в 1642 году "История монстров" Альдрованди, сочетавшая описание правдоподобных (волосатые люди, гиганты, карлики и сросшиеся близнецы) и фантастических историй (почерпнутые из Плиния рассказы о циклопах, сатирах и сциаподах), устарела уже при выходе. Трактат Фортунио Лицети, изданный в 1616 году, в основном посвящен детям с четко узнаваемыми аномалиями, как можно понять из фронтисписа, где они изображены в геральдических позах. Верно, что среди них есть теленок с человеческой головой и, конечно, Равеннский монстр. Но даже это самое ужасное из созданий выглядит почти идиллически, сжимая когтями стяг с написанным на нем названием книги.[3] В истории Англии XVII века был такой момент, когда во времена разорявшей страну гражданской войны произошло открытие мира природы, столь свежее и прозрачное по своему видению, каковое вряд ли когда-либо удастся еще раз обрести. То был момент, когда энергичная проза решительно отметала обломки интеллектуального наследия античности, а простые эксперименты могли обнажить красоту новой правды о природе. В Норфолке врач и эрудит сэр Томас Браун опубликовал свое произведение "Лженаука суеверий, или Исследование многих общепринятых заблуждений и всеми допускаемых истин" (1646). В этой странной и малоизвестной книге он рассматривает целый букет популярных предрассудков: о том, что перья мертвого зимородка всегда указывают, откуда дует ветер; что ноги у барсука с одной стороны короче, чем с другой; что негры потому черные, что их прокляли; что до потопа и в самом деле не было радуги, – и в заключение приходит к выводу: все это неправда. В другом труде, "Религия медика" (1642), он упоминает и монстров. Не существует, пишет он, "безобразного вне уродства; но, невзирая на это, в нем есть своя красота. Природа так искусно изобретает неверные части, что они подчас становятся более замечательными, чем основное Изделие". Это не есть в точности декларация научного натурализма, поскольку Браун видит в произведениях природы – в любом из них, даже в самом уродливом, – труды Господа, а коль они сотворены Богом, то не могут быть гадкими. Эти прекрасные фразы – призыв к милосердию в век нетерпимости.[4] В Оксфорде Уильям Гарвей, триумфально продемонстрировавший циркуляцию крови в организме, попытался решить проблему формирования животных. В 1642 году, присягнув королю, Гарвей удалился от суеты гражданской войны, занявшись изучением развития куриных эмбрионов, для чего использовал яйца наседки, живущей в Тринити-колледже. Итальянцы Альдрованди и Фабрициус уже проводили сходные исследования, причем Альдрованди занялся ими впервые после Аристотеля. Однако планы Гарвея шли гораздо дальше. Карл I наслаждался охотой на благородных оленей, которые водились и по сей день водятся в королевских парках Англии. Монарх позволил Гарвею препарировать убитых олених. Гарвей месяц за месяцем следил за развитием эмбрионов оленя и оставил одно из самых прекрасных описаний зародыша млекопитающих из всех когда-либо написанных. "Уже давно я видел плод, – писал он, – размером с гороховый стручок, вырезанный из матки оленихи, который был полностью сформирован во всех своих частях, и я показывал его королю и королеве. Он плавал, балансировал и достигал совершенства в такой белой, абсолютно прозрачной и кристально чистой жидкости (как будто ее хранили в наичистейшем стеклянном сосуде), объемом с голубиное яйцо, где он помещался в своей собственной оболочке". Король, по всей видимости, следил за опытами Гарвея с большим интересом. Горько думать, что после казни Карла I Англия потеряла монарха с такой склонностью к экспериментальной эмбриологии – случай, который едва ли скоро повторится в истории. На фронтисписе эмбриологического трактата Гарвея "О зарождении животных" (1651) изображен всемогущий Зевс, сидящий на орле и держащий в руке яйцо, из которого появляется все живое. На яйце начертан девиз: "Ех Ovo Omnia" – "Все из яйца". Именно благодаря утверждению, что генерации млекопитающих, кур, а также всех остальных существ в корне похожи, труд Гарвея остается известным и поныне, хотя сам ученый никогда не использовал этот девиз и не пытался доказать его правоту. У Гарвея было что сказать и по поводу рождения уродов. Он вспоминает и выносит на обсуждение мысль Аристотеля о том, что цыплята-монстры появляются из яиц с двумя желтками. Казалось бы, не слишком большое достижение. Однако то было выражение идеи, забытой на два тысячелетия, что причины уродств – не повод для досужих спекуляций, коими занимались Паре и Лицети, а проблема, поддающаяся экспериментальной трактовке.[5] Однако установить истинное значение уродства для науки смог современник Гарвея, который и сделал это с предельной четкостью. Речь идет о Фрэнсисе Бэконе, занимавшем какое-то время пост лорда-канцлера. Нам он известен своей репутацией самого хладнокровного интеллектуала. Его задачей было установить принципы, по которым должно происходить научное познание мира природы. В своем труде 1620 года "Новый органон" Бэкон начинает классифицировать естественную историю. Существует, говорит он, три типа естественной истории, которые "имеют дело либо со Свободой природы, либо с Ошибками природы, либо с Узами природы; так что мы можем сделать хорошее разделение на историю Рождений, историю Необыкновенных рождений и историю Художеств, причем последние мы также часто именуем Механическим и Экспериментальным Художеством". Другими словами, естественную историю можно разделить на изучение нормальной природы, аберрантной природы и природы, которая находится под воздействием человека. Бэкон продолжает свой рассказ, чтобы поведать нам, как приступить ко второй части его программы: "Мы должны создать коллекцию или специальную естественную историю всех уродов и чудесных произведений природы, куда войдет каждое новшество, раритет или аномалия". Конечно, Бэкон заинтересован в коллекционировании аберрантных предметов не ради них самих, а чтобы понять причины их своеобразия. Он не говорит о том, как познать эти причины, – он попросту верит, что однажды наука найдет способ это сделать.[6] Совет Бэкона о коллекционировании "уродов и чудесных / дивных произведений" вряд ли удивил бы его современников. Короли, правители вроде Рудольфа II и Фердинанда II австрийских собирали коллекции чудес с середины XVI века. Натуралисты также не оставляли это занятие без внимания: Улиссе Альдрованди собрал не менее 18 тысяч экспонатов в своем музее в Болонье. Идея Бэкона о том, что причины всяких странностей заслуживают изучения, также была вполне традиционна. Глубина его мысли становится очевидной, когда он переходит к вопросу о том, почему мы должны изучать причины аномалий. Бэкон не просто врач с узкими медицинскими интересами. Он философ с присущим философу желанием познать природу вещей. Главный пассаж предельно четок и ясен. Мы должны, говорит он, изучать случаи отклонения от нормы, "ибо, когда природа будет познана в своих вариациях и причины их станут ясны, будет нетрудно искусством добиться от природы того, чего она достигает случайно". На столетия опередив свое время, Бэкон признает, что поиск причин ошибок не есть самоцель, но, скорее, всего лишь средство. Уродливое, странное, отклоняющееся или просто иное, говорит он, открывает законы природы. И когда мы узнаем эти законы, мы сможем реконструировать мир по своему желанию.[7] В каком-то смысле эта книга есть промежуточный отчет по проекту Бэкона. Она не столько о человеческом теле, каким мы бы хотели его видеть, сколько о том, какое оно есть – с обилием вариаций и ошибок. Некоторые из этих вариаций – обычные различия, которые придают каждому из нас уникальное сочетание черт и являются тем самым основой нашего обаяния. Другие относятся к числу простых неудобств, которые занимают промежуточное положение между нормой и патологией. Есть и такие, которые возникают в результате явных ошибок в развитии. Они ухудшают, иногда трагически, жизнь тех, кто обладает ими, а порой они просто убивают их в раннем детстве. На самом краю спектра находятся уродства столь тяжелые, что их носителей с трудом можно принять за людей. Наказ Бэкона, что нам следует коллекционировать такие случаи, которые он именует "необыкновенными рождениями", может показаться неприятным. Наша нарочитая, нередко показная любовь к человеческому разнообразию быстро иссякает, когда разнообразие переходит в уродство. В стремлении искать, смотреть и, хотя и в меньшей степени, обсуждать уродства мы ощущаем дискомфорт от того, что рискуем впасть в наивное изумление (чтобы не сказать больше – порочное любопытство), жестокосердое глумление, или, в лучшем случая, боимся обрести вкус к бездумному собирательству. Этот наказ напоминает о королевских зверинцах, цирке П.Т. Барнума, фильме Тода Браунинга "Уродцы" (1932) и вообще о подвалах музеев, в которых пылятся экспонаты, предназначенные, по-видимому, для более крепких нервов наших предков. И тем не менее деятельность нельзя смешивать с целью. То, что для Бэкона было "монстрами" и "необыкновенными рождениями", для нас является всего лишь частью спектра человеческих форм. За прошедшие двадцать лет этот спектр, как никогда раньше, обследовался и изучался. По всему миру ученые выявляли людей, в той или иной степени отличающихся от обычных по своим физиологическим или внешним особенностям. Составлялись их списки, накапливались фотографии, выяснялись родословные. Таких людей находили в Ботсване и Бразилии, Балтиморе и Берлине. Из их вен брали образцы крови и отправляли в лаборатории для анализов. Их биографии, анонимные и сведенные к простым биологическим фактам, заполняли научные журналы. Они стали, вряд ли о том догадываясь, исходным материалом для грандиозного биомедицинского предприятия, возможно величайшего в наш век, в котором коллективно задействованы десятки тысяч ученых и которое имеет целью не что иное, как разъяснение законов развития человеческого организма. Большая часть этих людей имеет мутации, то есть дефекты некоторых генов. Мутации происходят из-за ошибок в механизмах копирования или репарации ДНК. Ко времени написания этой книги мутации, заставляющие некоторых из нас выглядеть, чувствовать или вести себя иначе, чем почти все остальные люди, обнаружены более чем в тысяче генов. Некоторые из таких мутаций уничтожают или, наоборот, добавляют к уже имеющимся целые куски хромосом. Другие поражают всего лишь один нуклеотид – единую структурную единицу ДНК. Физическая природа и степень мутации не столь, однако, важны, сколь ее последствия. Наследственные заболевания вызываются мутациями, которые изменяют генную последовательность ДНК, так что кодируемый ею белок приобретает иные, часто дефектные формы или вовсе не продуцируется. Мутации меняют смысл генов. Изменение значения одного гена может иметь исключительно далеко идущие последствия для генетической грамматики организма. Существует мутация, которая сделает вас рыжеволосым и толстым. Другая вызовет частичный альбинизм, глухоту и роковую склонность к запорам. Еще одна снабдит вас короткими пальцами на руках и ногах и неправильно сформированными гениталиями.[8] Меняя смысл генов, мутации наводят нас на мысль о том, чем в первую очередь являются эти гены для организма. В совокупности они представляют собой Розеттский камень[9], который позволяет выявить скрытое значение генов. В сущности это скальпель, который врезается в структуру генетической грамматики и обнажает ее логику. Для интерпретации значения мутаций потребуется использование обратной логики (контрлогики), которая для начала противоположна интуиции. Если мутация заставляет ребенка родиться без рук, то, хотя и есть соблазн сказать о гене "безрукости", такая мутация в действительности свидетельствует о гене, который помогает обеспечить наличие рук у большинства людей. Это происходит потому, что большинство мутаций уничтожают смысл. На языке генетики это – мутации "утраты функций". Незначительная часть мутаций добавляет смысл и называется мутациями "приобретения функций". При интерпретации значения мутации важно знать, с которой из них мы имеем дело. Один из способов состоит в том, чтобы узнать, как они наследуются. Мутации "утраты функций", как правило, рецессивны: они поражают организм ребенка только тогда, когда он наследует дефектные гены от обоих родителей. Мутации "приобретения функций" тяготеют к доминантности: для проявления должного эффекта ребенку нужна только одна копия гена. Хотя это разграничение нельзя считать окончательным (некоторые доминантно наследуемые мутации приводят к утрате функций), оно дает хорошую изначальную ориентацию. Обретая или теряя, оба вида мутаций рассказывают нечто о функции поражаемых ими генов и тем самым объясняют небольшую часть генетической грамматики. Мутации позволяют деконструировать тело. Кто же такие мутанты в конце-то концов? Сказать, что последовательность данного гена имеет "мутацию", или назвать носителя подобного гена "мутантом" значит дать довольно-таки обидную характеристику, которая подразумевает по меньшей мере отклонение от некоего совершенного идеала. И все же люди отличаются друг от друга великим множеством особенностей, и эти различия, хотя бы отчасти, наследуются. Кто из нас обладает геномом геномов, тем самым, по которому будут оцениваться все другие геномы? На этот вопрос можно дать краткий ответ: никто. Конечно, тот самый геном человека, последовательность которого была опубликована в журнале "Нейчер" 15 февраля 2001 года, не является стандартом. Он представляет собой попросту комбинацию геномов неизвестного количества неизвестных людей. Как таковой, он особо не претендует на соответствие норме или совершенство (равно как и ученые, которые поддерживали и реализовывали этот великий проект, никогда не выдвигали подобных претензий). Случайность ни в малейшей степени не уменьшает ценности данной геномной последовательности. В конце концов, геномы любых двух людей идентичны на 99,9 процента, так что нуклеотидная последовательность любого из нас выявляет практически все обо всех. С другой стороны, протяженность генома почти в 3 миллиарда пар оснований предполагает существование различий между любыми двумя людьми в несколько миллионов пар оснований. Эти-то различия и представляют для нас особый интерес. Если идеального или нормального генома не существует, то сможем ли мы найти эти качества у отдельно взятого гена? Возможно. Все наши 30 тысяч генов показывают, по крайней мере, некоторое разнообразие. До самого последнего поколения жителей Земли в каждой паре оснований генома человека мутации происходили в среднем 240 раз.[10] Не все из этих мутаций меняли смысл генов или вообще затрагивали их. Некоторые вносили в обширные участки генома изменения, казалось бы лишенные смысла. Не содержащие генов, которые воздействовали бы на грамматическую структуру организма, эти области вновь и вновь подвергаются мутациям. Скальпель делает свое дело, но без последствий для тела или разума человека. Другие мутации поражают кодирующие области генов, фактически не изменяя последовательности кодируемых ими белков. Они также хранят молчание. Из всех мутаций, меняющих смысл генов, небольшая их часть окажется выгодной для организма, и с течением времени эти мутации станут более частыми. На самом деле настолько частыми, что будет едва ли справедливо вообще именовать их мутациями. Вместо этого мы называем их вариантами, или, более научно, аллельными формами генов (полиморфизмами). В Африке частота аллеля Δ32 гена CCR5 в настоящее время увеличивается, поскольку он способствует резистентности организма к вирусу иммунодефицита человека и, соответственно, к СПИДу. Это новое явление, однако многие полиморфные гены приобретены в древности. Они – тот материал, на котором основывается разнообразие человечества. Они дают нам различия в цвете кожи, росте, весе и чертах лица; они также наверняка определяют, хотя бы и отчасти, наши различия в темпераменте, интеллекте, вредных привычках. Они могут вызвать болезни, но по большей части – болезни пожилого возраста, такие как старческое слабоумие или инфаркт. Насколько распространенной должна быть мутация, прежде чем стать полиморфизмом? Ответ на этот вопрос довольно произволен, но считается, что если измененная последовательность встречается с глобальной частотой в один процент или более, то она не могла причинять ранее большого вреда, а, напротив, могла быть даже выгодна для своих носителей. Согласно этому критерию, по крайней мере, один полиморфный участок обнаруживается примерно в 65 процентах человеческих генов, изученных на этот предмет. Некоторые гены насчитывают десятки их. Это разнообразие не должно ошеломлять нас. Большинство человеческих генов имеют всего один вариант, намного более распространенный по сравнению с остальными, и поэтому вполне разумно говорить об этом варианте как о нормальном, хотя бы только в статистическом смысле. Проблема идеала намного сложнее. Единственная причина считать один генетический вариант "лучше" другого – это повышенный репродуктивный успех его носителей, то есть их более высокая приспособленность, по Дарвину, по сравнению с носителями других вариантов. Наиболее обычный вариант, вероятно, оказывается лучшим в большинстве обстоятельств, однако доказать это невозможно, так как частоты генных вариантов определяются историей, и то, что было лучшим когда-то, вовсе не обязательно окажется лучшим сейчас или в будущем. Предпочитать один из вариантов другому – или, скорее, предпочитать то, каким он себя, на наш взгляд, обнаруживает, – значит попросту следовать своему вкусу. Под этим я понимаю такое, например, утверждение, сделанное великим французским натуралистом Жоржем Леклерком Бюффоном, что из-за светлой кожи и темных глаз женщины Кавказа красивее всех остальных. Или панегирик Карен Бликсен в адрес моранов[11] у масаев. Признавая генетическое разнообразие человека и даже получая от этого удовольствие, мы не должны впадать, однако, в далеко идущий генетический релятивизм. Многие из поражающих геном мутаций, согласно любому критерию, наносят организму вред. Каждый новый эмбрион имеет около сотни мутаций, которых не было у его родителей.[12] Эти новые мутации, уникальные для данного сперматозоида или яйцеклетки, были приобретены в то время, пока эти клетки находились в гонадах родителей, и не присутствовали тогда, когда родители эмбриона сами пребывали в зародышевом состоянии. Из этой сотни мутаций около четырех меняют значение генов путем изменения аминокислотных последовательностей белков. Из этих четырех меняющих смысл мутаций примерно три окажутся вредоносными. Или, выражаясь точнее, они окажут влияние на окончательный репродуктивный успех эмбриона, по крайней мере в такой степени, чтобы со временем обеспечить их уничтожение под действием естественного отбора. Мы не располагаем точными цифрами: доля вредных мутаций может быть рассчитана только непрямыми методами. Если расчеты верны, результаты их выглядят устрашающе. Они говорят нам, что нашему здоровью и счастью постоянно угрожает неиссякаемый запас генетических ошибок. Однако дело обстоит еще хуже. Каждый из нас отягощен не только своим собственным уникальным набором вредных мутаций, но должен справляться с тем, что мы унаследовали от родителей, а они – от своих родителей и так далее. Каков общий груз мутаций, испытываемый в среднем человеком? Продолжительность периода времени, в течение которого данная мутация будет передаваться от одного поколения к другому, зависит от тяжести ее воздействия на организм. Если предположить, что средняя мутация оказывает лишь незначительный вредоносный эффект на репродуктивный успех и поэтому сохраняется в течение сотен поколений, то оценка в три новых мутации на поколение приведет нас к довольно-таки печальному выводу, что любое вновь зачатое человеческое существо в среднем несет в себе триста мутаций, которые в той или иной степени ухудшают его здоровье. Ни один из нас полностью не свободен от этой мутационной бури. Но – и это безусловная правда – не все мы в равной степени подвержены ее воздействию. Некоторые из нас, по воле случая, рождаются с необычно большим числом умеренно вредных мутаций, тогда как у других их довольно мало. И хотя одни из нас, опять-таки по воле случая, рождаются с единственной мутацией полностью разрушительного действия, большинство людей с ней не знакомы. Так кто же в таком случае они такие – мутанты? Ответ может быть только один, и он полностью согласуется с нашим каждодневным опытом разграничения нормы и патологии. Мы все мутанты, но некоторые из нас в большей степени, чем другие. Глава II Безупречное соединение [о невидимой геометрии эмбрионов] Сросшиеся близнецы – Пигопаги, Юдит и Элен (1701-1723). Из книги Жоржа Леклерка Бюффона "Естественная история: всеобщая и частная", 1777 (Библиотека Уэллком, Лондон). В томе гравюр, сопровождающем отчет об их анатомировании, Рита и Кристина Пароди выглядят парочкой небольших, изящных и довольно-таки хорошеньких девочек. У обеих черные глаза, а шелковистые кудряшки зачесаны вперед на лоб, по моде Французской империи, заставляя вспомнить парадный портрет Наполеона Бонапарта. У них прямые бровки и носики, рты приятно очерчены, а ручонками они тянутся друг к другу, как будто пытаясь обняться. Однако лица у них, в стиле того времени, строгие. Разделенные на уровне плеч и выше, туловищами они срослись. Ниже общего пупка это соединение достигает такой полноты, что на двоих у них имеются одни половые органы, один таз и одна пара ног. Это пример парадоксальной геометрии, так как, хотя каждая из девочек по отдельности столь сильно изуродована, взятые вместе они симметричны и пропорциональны; их телесная конструкция кажется в меньшей степени аномалией природы, чем достижением желаемого результата. Можно даже подумать, что видимая красота есть лишь следствие искусства гравера, но сделанная с их тела гипсовая отливка являет ту же гармонию форм. Если гравер в чем-то и ошибся, так это в пропорциях тела: они соответствовали бы детям более старшего возраста. Рите и Кристине к моменту смерти было всего восемь месяцев. Сросшиеся близнецы – парапагус дицефалус тетрабрахиус, Рита и Кристина Пароди, 1829 г. Из книги Этьена Серра "Исследования по анатомии трансцендентной и патологической", 1832 (Британская библиотека). Апофеоз Риты-Кристины Семья Пароди приехала в Париж осенью 1829 года, за шесть месяцев до того покинув Сассари, провинциальный городок на Сардинии, в надежде зарабатывать на жизнь демонстрацией своих детей. В Италии им сочувствовали, в Париже – нет. Местные магистраты, заботясь об общественных приличиях, запрещали Пароди показывать девочек публично и тем лишали их единственного источника дохода. Семейство поселилось в заброшенном доме на окраине Парижа, где им удавалось получать кое-какие деньги от вереницы врачей и философов, которые желали частным образом посмотреть на детей.[13] Но этих доходов не хватало даже на обогрев дома. К тому же ученые мужи, пытаясь понять, что же перед ними такое, постоянно норовили снять с детей одежду и одеяло. Одно у них сердце или два? Стетоскоп давал противоречивые ответы. Визитеры приходили в восторг от различий между детьми. Кристина была само очарование: здоровенькая, живая, с отменным аппетитом; Рита, напротив, – слабенькая, хнычущая, синюшная. Когда одна засыпала, другая обычно тоже впадала в сон, но случалось и так, что одна крепко спала, а другая требовала пищи. Из-за постоянного переохлаждения Рита подхватила бронхит. Врачи констатировали заболевание, отмечая при этом различную, хотя и взаимозависимую реакцию девочек, так как даже когда Рита задыхалась от нехватки воздуха, ее лежащая рядом сестра не испытывала никаких затруднений и выглядела довольной. Однако спустя три минуты после смерти Риты Кристина издала крик, и ее ручонка, в тот момент находившаяся в материнской ладони, обмякла. Это случилось 23 ноября 1829 года, после чего для "двухголовой девочки Риты-Кристины" началась вторая, посмертная жизнь. Люди из Королевской академии медицины появились в доме в считаные часы. Они хотели сделать слепок с тела. Вслед за ними прибыли делегации анатомов; этим нужно было само тело. Как им удалось его заполучить – история умалчивает, известно только, что в ближайшие же дни было объявлено об анатомировании ребенка-бицефала. Процедура состоялась в просторном амфитеатре Музея естественной истории, расположенном в парижском Ботаническом саду. Мертвые Рита и Кристина лежали на простом деревянном столе. Вокруг них теснились анатомы. Там был барон Жорж Кювье – величайший анатом Франции, "французский Аристотель". Присутствовал и Изидор Жоффруа Сент-Илер, знаток аномалий, который через несколько лет станет основателем тератологии. Наконец, здесь же находился Этьен Рено Огюстен Серр, блистательный молодой врач из клиники де ля Питье, который сделает себе имя, описав анатомическое строение девочек в трехсотстраничной монографии. За стенами музея в городе кипели страсти. "Курьер Франсе" сообщал, что мужи от медицины попустительствовали смерти сестер; те ответствовали, что всему виной магистрат, по чьей вине семья впала в ужасную нищету. Журналист, писатель и критик Жюль Жанен опубликовал опус "Я обвиняю" в три тысячи слов, заклеймив анатомов, осмелившихся скальпелем прикоснуться к поэтической тайне, которую несли в себе Рита и Кристина: "Вы уничтожили сей прекрасный труп, вы низвели монстра до уровня обычных людей, а когда все было кончено, оставили только жалкую его тень". В заключение он высказал мысль, что судьба девочек может послужить прекрасным сюжетом для романа. Первый надрез обнажил ребра.[14] Присоединенные к единственной грудине, они охватывали обеих сестер, но сзади прикреплялись к двум отдельным позвоночным столбам, которые, изящно изгибаясь, вели к общему тазу. В груди было два сердца, которые помещались внутри общего перикардия. Сердце Риты было сильно деформировано: клапаны предсердий перфорированы, имелись две верхние полые вены, одна из которых открывалась в левый желудочек, а другая – в правый, чем, вероятно, и объяснялся цианоз девочки. Если бы не было этого дефекта, сокрушался Серр, и дети жили бы в более благоприятных условиях, они наверняка доросли бы до взрослого возраста. Два пищевода вели к двум желудкам, двум ободочным и толстым кишкам, которые затем соединялись в общую прямую. У каждой из девочек были матка, яичники и фаллопиевы трубы, но только один набор половых органов соединялся с влагалищем, другой остался небольшим и недоразвитым. Но самым замечательным было то, что у Кристины сердце, желудок и печень были ориентированы вполне нормально, а у Риты – расположены в противоположной по отношению к сестре стороне, так что внутренние органы девочек были зеркальным отражением друг друга. Анатомы закончили свою работу и принялись вываривать скелет для последующего экспонирования. Пара напольных часов Самое древнее из известных изображений пары сросшихся близнецов – это статуя с раскопок неолитического святилища в Анатолии. Высеченная из белого мрамора, она изображает парочку коренастых немолодых женщин, соединенных на уровне бедер. Через три тысячи лет после того как была изготовлена статуя, австралийские аборигены увековечили память о сросшихся близнецах-дицефалах (две головы, одно тело) на скале неподалеку оттого места, где ныне располагаются пригороды Сиднея. Спустя еще две тысячи лет (в 700 году до н.э.) в греческом искусстве геометрического стиля появляются сросшиеся братья Молиониды, которых звали Эврит и Ктеат. Один из них был сыном бога Посейдона, а второй – смертного царя Актора. Несмотря на разных отцов, у братьев было общее туловище и четыре руки, в каждой из которых зажато копье. В одном кентском приходе ежегодно в пасхальный понедельник бедным раздают караваи хлеба, выпеченные в виде двух женщин, сросшихся боками. Говорят, что эта традиция восходит к временам завоевателей-норманнов и призвана напомнить о живших здесь когда-то сросшихся близнецах.[15] К XVI столетию сросшиеся близнецы начинают появляться в различных антологиях о чудовищах и чудесах с той же монотонной регулярностью, с какой в наши дни о них пишут британские таблоиды или "Нью-Йорк пост". Амбруаз Паре описывает не менее тринадцати случаев; в их числе две девочки, соединенные спинами, две сестры, у которых срослись лбы, два мальчика с одной головой и два младенца с общим сердцем. В 1560 году Пьер Боэстюо преподнес украшенный миниатюрами манускрипт своих "Чудесных историй" Елизавете I, королеве английской. Среди демонических созданий, диких людей и падших монархов есть изображение двух молодых женщин, стоящих на лугу на общей паре ног, с ниспадающими на плечи огненно-рыжими волосами. Они напоминают двух Венер Боттичелли, которые каким-то образом соединились друг с другом. Для искателей аллегорий сросшиеся близнецы означали политический союз. Боэстюо отмечает, что другая пара итальянских сросшихся близнецов родилась в тот самый день, когда воюющие города-государства Генуя и Венеция наконец-то объявили о перемирии, и это не просто совпадение. Монтень, однако, придерживается иных взглядов. В своих "Опытах" (ок. 1580) он описывает пару сросшихся близнецов, которые встретились ему, когда родители возили их в телеге по французским селам. Поначалу он приходит к мысли, что сросшиеся торсы и многочисленные конечности детей можно истолковать как символ способности короля объединять различные партии своего государства под сенью закона, но впоследствии отвергает эту идею. Он продолжает: "Те, кого мы именуем монстрами, таковыми не кажутся Господу, который в грандиозности своего труда видит бесконечные формы, в нем содержащиеся".[16] Сросшиеся близнецы не отражают взгляды Бога на ход земных дел. Они символизируют Его могущество.[17] Сросшиеся близнецы – парапагус дицефалус дибрахиус, Нормандия. Из книги Пьера Боэстюо "Чудесные истории", 1572 (Библиотека Уэллком, Лондон). К началу XVIII века этот гуманистический порыв, тот же самый, что заставил сэра Томаса Брауна столь сочувственно писать об уродствах, приходит к логическому завершению. В 1706 году Жозеф Гишар Дюверне, хирург и анатом из парижского Королевского ботанического сада, то есть как раз из того места, где проходило вскрытие Риты и Кристины, анатомировал еще одну пару близнецов, сросшихся бедрами. Под впечатлением совершенства этого соединения Дюверне заключил, что оно, вне сомнения, являет собой доказательство "многообразия действий Создателя", который явно предназначил им стать такими, какие они есть. Ведь поскольку Бог ответствен за форму эмбриона, он ответственен и за всякие ее нарушения. По сути дела, уродливые младенцы не означают в действительности, что с зародышем произошло что-то не то, а являют собой часть Божьего промысла. Тела, писал Дюверне, подобны часам. Предположить, что тела сросшихся близнецов так хорошо пригнаны друг к другу без вмешательства Господа, столь же абсурдно, сколь представить, будто можно взять пару напольных часов, мощным ударом соединить их вместе и надеяться, что они сольются в единое целое и начнут отсчитывать время. Другим эта мысль казалась нелепой. Конечно, возражали они, Бог, в конечном итоге, полностью отвечает за порядок в природе, но предполагать, что Он намеренно проектирует ущербные яйцеклетки или сперму как проявления творческого разнообразия, – полная глупость. Если тела – это часы, тогда вокруг найдется немало таких, которые едва ли принесут славу Часовщику. Чудовища – не доказательство Божьего промысла, а всего лишь результат неприятных случайностей.[18] Конфликт между этими двумя радикально противоположными точками зрения на уродство как результат Божьего промысла или неприятного случая известен под названием "спора о монстрах" ("la querelle des monstres"). Он на десятилетия разделил французских анатомов на два лагеря, при этом удары, которыми обменивались противники, публиковались в "Записках Королевской академии наук" (Mémoires de l'Académie Royale des Sciences). Речь шла не просто о теологической дискуссии, а о борьбе двух различных точек зрения на формирование эмбрионов. Дюверне и его последователи были преформистами. Они утверждали, что каждая яйцеклетка (или, согласно одной из версий этой же теории, каждый сперматозоид) несет в себе законченный эмбрион, хотя и крошечный, с готовыми конечностями, печенью и легкими. Но еще удивительнее было то, что этот малюсенький зародыш (которого будто бы видели в микроскоп некоторые ученые) также содержал в себе яйцеклетки и сперматозоиды, внутри которых, в свою очередь, находился зародыш... и так далее, до бесконечности. Согласно этим рассуждениям, каждый из яичников Евы содержал в себе все будущее человечество. Теория преформизма отличалась оригинальностью, и среди ее приверженцев было немало выдающихся имен. И все же многие философы XVII-XVIII веков, в числе которых были такие мыслители и вольнодумцы, как Бюффон и Мопертюи, предпочитали эту версию более старой теории эпигенеза. Согласно последней, эмбриональный ряд не существовал сам по себе в яйце или сперме, но скорее возникал спонтанно после оплодотворения. Во времена знаменитого "спора" многие думали, что преформизм отличается более обоснованными аргументами. Сегодня, однако, победителя назвать еще труднее. Ни у преформистов, ни у эпигенетиков не было вразумительной теории наследования, так что термины, которыми они пользовались в ходе дебатов, никак не соответствуют современному пониманию причин, вызывающих уродства или определяющих развитие организма. Из двух теорий преформизм с его бесконечной, идущей вспять цепочкой эмбрионов кажется более нелепым, хотя в одном из его утверждений содержится привлекательная мысль о том, что нарушения развития часто (но вовсе не обязательно) происходят вследствие ошибок, присущих самим зародышевым клеткам (которые станут яйцом или сперматозоидом) или, по крайней мере, их ДНК. Но сторонники эпигенеза были сильны в своих высказываниях о том, что эмбрионы вовлечены в процесс самосозидания, который может нарушаться внешними воздействиями, химическими веществами или подобными им агентами – и даже случайными событиями внутри делящихся клеток.[19] Как получить сросшихся близнецов Что же заставляет близнецов срастаться? Аристотель, по обыкновению, перечисляет основные варианты. В одном месте своего труда "О возникновении животных" он утверждает, что сросшиеся близнецы происходят из двух зародышей, которые соединились вместе. Так, по крайней мере, он пишет, объясняя появление сросшихся цыплят (у которых по четыре крыла и по четыре ноги). Однако в других местах он высказывает предположение, что близнецы появляются из одного эмбриона, который разделился на два.[20] По современным представлениям, его рассказ о делении эмбриона звучит весьма странно, но это вполне изощренное описание, согласующееся с его теорией развития эмбриона. Не имея микроскопа, Аристотель ничего не знал о существовании сперматозоидов и яйцеклеток. Вместо этого он предполагал, что эмбрион образуется путем сгущения из смеси менструальной жидкости и семени, причем последнее заставляет менструальную жидкость свертываться подобно тому, как – используя его бесхитростную метафору – сок смоквы вызывает скисание молока при изготовлении сыра. Это эпигенез до его появления. В самом деле, преформизм очень усердно нападал на аристотелевскую теорию эмбриогенеза и, в продолжение ее, на его взгляды по поводу происхождения уродств. Иногда, говорит Аристотель, имеется чересчур много доэмбриональной смеси. Если излишек смеси невелик, рождаются дети с лишними или чересчур большими частями тела, например с шестью пальцами или чрезмерно развитой ногой. Если ее больше, рождаются сросшиеся близнецы; при еще большем количестве – раздельные близнецы. Он использует прекрасный образ для описания того, как разделяется смесь при образовании двух индивидуумов. Они получаются, говорит он, в результате действующих внутри матки сил, сравнимых с водопадом: "...как вода в реке движется с некоторой скоростью, и если сталкивается с препятствием, то из одного потока образуется два, причем каждый сохраняет то же самое движение; так же случается и с эмбрионом". По Аристотелю, два способа возникновения сросшихся близнецов отражаются на их индивидуальности. Он утверждает, что если у сросшихся близнецов два отдельных сердца, то они происходят от двух зародышей и являются двумя индивидуумами; если же сердце одно, то и они – одна особь. Вопрос об индивидуальности сросшихся близнецов неотступно следует за ними на протяжении всей истории. Фома Аквинский полагал, что это зависит от количества сердец и голов (тем самым повергнув священников в постоянные сомнения относительно того, сколько обрядов крещения им нужно совершать в случае сросшихся близнецов).[21] Когда близнецы соединены одной только узкой хрящевой перемычкой, как это было в случае с настоящими сиамскими близнецами – Энгом и Чангом (1811-1874), гарантировать каждому его собственную идентичность не составляет труда. В сообщениях о Рите и Кристине Пароди девочки часто фигурируют как одно-единственное существо "Рита-Кристина" или даже как "девочка с двумя головами", а не две девочки с одним телом, каковыми они, в сущности, и являлись. Вплоть до недавнего времени дискуссии о происхождении сросшихся близнецов по своей терминологии весьма напоминали объяснения Аристотеля: это результат либо слияния, либо разделения. Большинство медицинских учебников придерживалось последней версии. Монозиготные (идентичные) близнецы, согласно этим утверждениям, – это производные одного зародыша, который по воле случая разделился на два. А если эмбрион может разделиться полностью, то он, конечно, может разделиться и частично. Довод привлекает своей простотой. Правда и то, что сросшиеся близнецы почти всегда монозиготны – они происходят из одной яйцеклетки, оплодотворенной одним сперматозоидом. Однако существуют некоторые подозрения, что монозиготные близнецы, родившиеся сросшимися, возникают в результате совершенно иных событий, имеющих место в первые несколько недель после зачатия, чем те, которые родились разделенными. Одно различие между сросшимися и раздельными близнецами состоит в том, что у первых общая плацента и (как это и должно быть в их случае) общий амниотический мешок. Раздельные близнецы также имеют общую плаценту, однако амниотический мешок у них, как правило, у каждого свой. Поскольку амниотический мешок образуется после плаценты, можно предположить, что разделение – если таковое имеет место – у сросшихся близнецов происходит позже, чем у отдельных. Еще одно заставляющее задуматься различие заключено в странной статистике половой принадлежности близнецов – пятьдесят процентов раздельных монозиготных близнецов рождаются девочками. Это несколько выше, чем можно было бы ожидать, так как в большинстве популяций чаще рождается чуть больше мальчиков, чем девочек. Но у сросшихся близнецов эта пропорция сильно скошена в сторону женского пола: в подавляющем числе случаев – около 77 процентов – это девочки. Никто не знает, почему так происходит, но этот факт четко объясняет, почему в изображениях сросшихся близнецов – от неолитических святилищ до "Нью-Йорк пост" – так часто встречаются женщины.[22] Вероятно, лучший аргумент в пользу предположения, что сросшиеся близнецы не есть результат частичного деления эмбриона, – это геометрия самих близнецов. Они могут быть соединены головами, грудными клетками, животами или бедрами; ориентированы по отношению друг к другу животами, боками или спинами. При этом каждое из подобных соединений может быть либо таким слабым, что у них практически отсутствуют общие органы, либо таким тесным, что все их органы общие. Трудно понять, как такое удивительное разнообразие телесных конфигураций может возникать за счет простого деления эмбриона на два. Но где же, если не в частичном разделении эмбриона, следует искать причину происхождения сросшихся близнецов? Сэр Томас Браун называл чрево "непостижимым миром", и это сущая правда, в особенности в том случае, когда мы пытаемся объяснить появление сросшихся близнецов. Новейшие данные, однако, наводят на мысль, что аристотелевская дихотомия – слияние или разделение – обманчива. Чтобы получить сросшихся близнецов, нужно, во-первых, создать двух эмбрионов из одного, а затем прикрепить их друг к другу. Более того, способ, с помощью которого два эмбриона возникают из одного, не имеет ничего общего с грубым механическим делением эмбриона. На самом деле это нечто гораздо более изящное и занимательное. Действительно, хотя мы воспринимаем сросшихся близнецов как самую причудливую из всех форм, которые может принимать человеческое тело (совсем еще недавно, всего-то в 1996 году, "Таймс", описывая одну пару сросшихся близнецов, назвала ее "метафизическим оскорблением"), они показывают нам приемы, с помощью которых наш организм получает инструкции, находясь внутри матки.[23] Сформируйте меня На седьмой день после зачатия человеческий эмбрион начинает зарываться.[24] Всего-навсего полый шар, состоящий из сотни или около того клеток, он способен внедриться в слизистую оболочку матки материнского чрева, которая размягчается и набухает за счет действия гормонов менструального цикла. Большая часть клеток полого шара занята проблемой закапывания, но есть и такие, которые ведут себя по-другому. Они начинают образовывать собственный шар, так что к девятому дню эмбрион становится похожим на одну из оригинальных китайских игрушек: вырезанные из слоновой кости шарики находятся один внутри другого – сфера внутри сферы внутри сферы и так далее... К тринадцатому дню он исчезает в выстилающем слое слизистой матки, и оставленная им рана обычно легко заживает. Эмбрион приступает к самоустройству. Первая его задача – создать исходный материал для своих органов. Мы трехмерные существа: кожный чехол окружает слои костей и мышц, которые, в свой черед, служат опорой для лабиринта внутренней сантехники. Но перед эмбрионом встает проблема. Из той сложной структуры, которую он уже построил, лишь небольшая ее часть – крошечный комочек клеток внутренней сферы – действительно предназначена для продуцирования плода. Все остальное послужит только для создания вспомогательного оборудования: плаценты, пупочного канатика и других подобных атрибутов. А для того чтобы из этого конгломерата клеток получился плод, зародыш должен реорганизовать себя. Процесс, с помощью которого это делается, называется гаструляцией. Примерно на тринадцатый день после зачатия комочек клеток превращается в диск с полостями над (будущая амниотическая полость) и под ним (будущий желточный мешок). Примерно на середине диаметра этого диска появляется желобок, так называемая "первичная полоска". Клетки начинают мигрировать в сторону этой полоски и погружаются в нее. Первые из клеток, которые проходят этот путь, образуют выстилку вокруг желточного мешка. Новые клетки, проникающие в полоску, образуют над первым другой слой. В результате эмбрион приобретает три слоя вместо одного и становится гаструлой. Три слоя гаструлы – это предвестники наших органов. Верхний слой, эктодерма, станет наружными слоями кожи и большей частью нервной системы; ниже расположена мезодерма – будущие мышцы и кости; вокруг желтка находится эндодерма – исходный материал для кишок, поджелудочной железы, селезенки и печени. (Термины происходят от греческих слов ecto-, meso- и endo- – внешняя, средняя и внутренняя; и -derm – соответственно кожа.) Это разграничение выглядит довольно четким, однако в действительности многие части нашего тела – зубы, молочные железы, руки, ноги, половые органы – представляют собой сложную комбинацию из эктодермы и мезодермы. Но еще важнее материала, из которого в дальнейшем строятся органы, является то, что эмбрион в это время также приобретает геометрическую структуру, которая сохранится на всю оставшуюся жизнь. Через две недели после встречи яйцеклетки и сперматозоида у зародыша появляются голова и хвост, перед и зад, левая и правая стороны. Вопрос состоит в том, откуда они берутся. Весной 1920 года в немецкий университетский город Фрейбург приехала Хильда Прешельдт. Ей предстояло приступить к работе с Гансом Шпеманом, одной из наиболее значительных фигур в новой, в основном немецкой, науке – Entwicklungsmechanik, механике развития. Стекловидные зародыши морских ежей делились пополам; гидры с зелеными щупальцами теряли головы с тем, чтобы отрастить их вновь; лягушки и тритоны существовали лишь для того, чтобы отложить икру, предназначавшуюся для сложных экспериментов по трансплантации. Шпеман был главой этого научного направления, и Прешельдт предстояло делать в его лаборатории кандидатскую диссертацию. Поначалу она с трудом пыталась понять, чего от нее хотят. Эксперименты, которые предложил ей Шпеман, казались технически невыполнимыми, и, оценивая их в ретроспективе, следует признать, что таковыми они и были. Но Хильда была способной, настойчивой и знающей сотрудницей. Весной 1921 года Шпеман предложил ей новое направление в работе. Его результаты должны были дать первые представления о том, как происходит упорядочивание эмбриона. Тогда, как и сейчас, скрытая цель большинства исследований в области биологии развития состояла в том, чтобы понять, как строят себя человеческие эмбрионы, или, если это не удавалось, выяснить, что происходит с эмбрионами других млекопитающих. Но с эмбрионами млекопитающих трудно работать. Их нелегко найти и трудно сохранить живыми вне матки. Иначе обстоит дело с эмбрионами тритонов. Тритоны в изобилии откладывают мельчайшие яйцеклетки, которые, при определенной практике, поддаются хирургическим манипуляциям. Можно было даже пересаживать кусочки тканей от одного эмбриона к другому и наблюдать за их приживлением и ростом. Эксперимент, предложенный Хильде на тот момент Шпеманом, заключался в иссечении кусочка ткани с дальнего конца бластопора (у тритонов эквивалентного первичной полоске человека) одного из эмбрионов и трансплантации его другому эмбриону. Заметив, что слои тканей и конфигурация эмбриона зависят от клеток, прошедших через бластопор, Шпеман предположил, что ткани губы бластопора обладают особым свойством инструктировать клетки, которые мигрируют мимо них. Если это так, тогда эмбрионы с дополнительно имплантированными в них участками губы бластопора будут отличаться – чем? Избыточным количеством мезодермы и эктодермы? Фатально нарушенной геометрической структурой? Совершенно нормальным развитием? Эксперименты, проведенные ранее самим Шпеманом, давали интригующие, но противоречивые результаты. Теперь Хильде Прешельдт предстояло сделать все как надо. В промежутке между 1921 и 1923 годами она выполнила 259 экспериментов по трансплантации. Большинство ее эмбрионов не пережило операции. Но шестеро из тех, кому это удалось, стали в ряд наиболее знаменитых персонажей биологии развития, так как каждый из них содержал заготовку не для одного, а для двух тритонов. У них были зачатки двух голов, двух хвостов, двух нервных трубок, двух наборов мышц, двух спинных струн и двух кишечников. Хильда Прешельдт создала сросшихся близнецов тритонов, ориентированных живот к животу. Это было невероятно, но истинная красота эксперимента состояла в том, что Прешельдт использовала в качестве донора и хозяина тритонов двух различных видов. Обычный тритон, сыгравший роль донора, отличался темнопигментированными клетками, в то время как большой гребенчатый тритон, выполнявший функцию хозяина, их не имел. Стало ясно, что дополнительные органы принадлежали эмбриону хозяина, а не донора. Это означало, что трансплантированный участок губы бластопора не сделался добавочным тритоном, а скорее индуцировал его из недифференцированных клеток хозяина. Этот крошечный кусочек ткани, по-видимому, обладал могущественными инструкциями по созданию совершенно новой особи, почти законченной во всех ее частях. Шпеман, без всякой склонности к преувеличению, назвал дальний конец губы бластопора тритона "организатором". Под этим наименованием он до сих пор фигурирует в науке.[25] В течение семидесяти лет специалисты по биологии развития тщетно искали источник могущества организатора, или организационного центра. Они приблизительно знали, что ищут: молекулу, секретируемую одной клеткой, которая сообщает другой клетке, что делать, кем стать и куда направиться. Довольно скоро выяснилось, что сила организатора заключена в небольшом участке мезодермы, расположенном прямо под губой бластопора. Идея была проста: клетки, мигрирующие через бластопор внутрь эмбриона, наивны и несведущи, но их потенциал безграничен. Шпеман по этому поводу произнес следующий афоризм: "Мы стоим и ходим с помощью таких частей нашего тела, которые вполне могли использоваться для мыслительного процесса, если бы развивались в другой части эмбриона". Мезодермальные клетки края бластопора были источником сигнала, который проникал внутрь эмбриона, или, если пользоваться вскорости изобретенным термином, – морфогена. Этот сигнал сохранял всю свою силу возле его источника, но по мере удаления от него становился все слабее и слабее. Говоря вкратце, в концентрации морфогена существовал трехмерный пространственный градиент. Клетки воспринимали его и в точности знали, где и какими им следует быть. Если стимул был сильным, эктодермальные клетки образовывали спинной мозг, который проходит по всей длине нашего позвоночника. Если же он был слабым, они становились кожей, покрывающей наше тело. Та же логика применима и к другим зародышевым листкам. При сильном сигнале организатора мезодерма превращалась в мышцы, при слабом – в почки, при еще более слабом – в соединительную ткань и клетки крови. В обязанности организационного центра входило моделирование расположенных под ним клеток.[26] Утомительно перечислять здесь многочисленные фальстарты, рассказывать о годах, потраченных на поиски организатора морфогенеза, о гекатомбах эмбрионов лягушек и тритонов, измельченных в поисках неуловимой субстанции. В итоге к 1960-м годам выросло убеждение, что проблема не имеет решения и заниматься ею не следует. "Наука, – как однажды выразился Питер Медавар, – это искусство находить решение". Но решения-то искусство того времени как раз и не могло предложить. В начале 1990-х годов для решения задачи была использована технология рекомбинантной ДНК. К 1993 году был выявлен белок, который при его инъекции в эмбрионы африканских шпорцевых лягушек приводил к появлению сросшихся близнецов головастиков. Наконец-то стало возможным повторить – без грубого хирургического вмешательства – те результаты, которые Хильда Прешельдт обнародовала много лет назад. Белок особенно подходил для того, чтобы превращать необученную эктодерму в спинной или головной мозг. По странной прихоти, которая господствует в этой области биологии, белок назвали "ноггин" ("noggin")[27]. К этому времени были разработаны такие технологии, которые позволяли увидеть, где именно в организме зародыша включаются и выключаются гены. Ген ноггина включался на дальнем конце губы бластопора, как раз в том месте, где и должен был находиться ген, кодирующий организатор морфогенеза. Ноггин – это сигнальная молекула, то есть молекула, с помощью которой одна клетка общается с другой. У животных имеется несчетное их число. Из 30 тысяч генов человеческого генома по меньшей мере 1200, по мнению генетиков, кодируют белки, участвующие в межклеточных коммуникациях. Они образуют большие семьи родственных молекул: трансформирующие факторы роста – бета (TGF-β), хеджхоги (hedgehogs)[28], фибробластные факторы роста (FGF). Мы назвали лишь некоторые, а иные семьи содержат их больше десятка. Способ, с помощью которого они работают, может варьировать в деталях, но принцип его один и тот же. Секретируемые одной клеткой, они прикрепляются к рецепторам на поверхности других клеток и, действуя таким образом, вызывают последовательность молекулярных событий в клетке-реципиенте. Цепочка информации в конце концов достигает ядра, где батареи других генов либо активизируются, либо угнетаются, и клетка подчиняется судьбе и принимает свою идентичность.[29] Сразу после обнаружения ноггина предполагалось, что его необыкновенные свойства заключаются в способности отличать заднюю сторону эмбриона от передней – или, точнее, в способности давать такие инструкции необученным клеткам эктодермы, чтобы они становились спинным мозгом, а не кожей. Ноггин, размышляли далее, стимулировал эктодермальные клетки к более высокой организации; без него они прозябали бы в виде жалкой кожи. Истина, однако, намного занимательнее. Вероятность того, что клетка дифференцируется в спинной мозг, а не в кожу, зависит не от количества ноггина, который связывается с ее рецепторами, а скорее от исхода молекулярного конфликта по поводу ее судьбы. Я уже говорил, что наши геномы кодируют несметное число сигнальных молекул. Это означает, что клетки нашего организма постоянно купаются во множестве сигналов, исходящих из множества источников. Некоторые из этих сигналов всегда однозначны, другие дают противоречивые советы. Ноггин организатора может побуждать клетки эктодермы становиться нейронами, но пока он это делает, с другой стороны эмбриона другая молекула – костный морфогенетический белок 4 (BMP-4) – дает инструкции тем же клеткам становиться кожей. Способ, которым эмбрион разрешает конфликт между этими двумя стимулами, весьма остроумен. Каждый сигнал имеет свой собственный рецептор, к которому он прикрепляется, а ноггин с его невероятной подвижностью может также присоединяться к свободным молекулам BMP-4, проникающим через межклеточное пространство, и выводить их из строя. Клетки, расположенные вблизи организатора, не только получают стимул становиться нейронами, но и испытывают тормозящее влияние, дабы не сделаться кожей. Вдали от организационного центра происходит прямо противоположное. Судьба любой клетки зависит от равновесия концентраций между двумя соревнующимися молекулами. Этот оригинальный способ – лишь один из многих подобных, работающих в процессе развития организма позвоночных, в больших или меньших масштабах, для самых разнообразных целей. Однако в данном случае речь идет о том, чтобы особь, будь то головастик или ребенок, имела бы переднюю и заднюю стороны. Некоторым образом эмбрион – это микрокосм того мира познания, в котором мы обитаем, мира сигналов, которые настойчиво побуждают нас отправиться в путешествие по тому, а не другому маршруту, пренебречь одними целями во имя других, считать одни представления истинными, а другие – ложными. Короче, это аналог того, как мы становимся тем, что мы есть.[30] В действительности довольно трудно доказать, что ген или кодируемый им белок выполняют именно то, что им приписывают. Одно из таких доказательств – уничтожить ген и посмотреть, что из этого получится. Это все равно что вынуть из автомашины какую-то деталь – к примеру, какой-нибудь неприметный винтик, – чтобы понять, для чего он там находится. Иногда отваливается зеркало заднего вида – только и всего, а иногда – перестает заводиться машина. Так же обстоят дела с мышами и генами. Если ноггин и в самом деле та самая давно искомая организующая молекула, то всякая мышь с дефектным геном ноггина должна отличаться в корне неправильным геометрическим строением. Из-за отсутствия информации клетки такого эмбриона не будут знать, где им следует находиться и что делать. Можно полагать, что у мыши, выросшей при отсутствии ноггина, не будет спинного или головного мозга, зато повсюду окажется живот. На худой конец, можно ожидать, что она умрет задолго до рождения. Как ни странно, когда в 1998 году с помощью генной инженерии была получена такая мышь с дефектом ноггина, она оказалась вполне здоровой. Правда, в спинном мозге и некоторых мышцах у нее наблюдались кое-какие аномалии, но они были абсолютно банальными по сравнению с тем, какими могли бы быть. Причины этого парадокса до сих пор до конца неясны. Вероятнее всего, они связаны со сложностью организатора. С момента обнаружения ноггина в нем найдено по крайней мере еще семь сигнальных белков, среди которых один получил зловещее название "цербер" ("cerberus", по имени трехголового пса, охранявшего вход в Аид), а другой – более простое, но обладающее не меньшим подтекстом название "диккопф" ("dickkopf") – по-немецки "упрямец". Такое многообразие озадачивает. Некоторые из этих белков, видимо, преследуют уникальные цели (например, смоделировать голову, а не хвост, или эктодерму, а не мезодерму). Но может быть и так, что одни из них могут заменять другие. Говоря о генах, выполняющих те же самые задачи, что и другие, биологи употребляют слово "излишний" в том же смысле, как это делают управляющие компаний, когда говорят о сотрудниках, увольнение которых не скажется на успехе дела. По меньшей мере два организационных сигнала – ноггин и другой, так называемый "хордин" ("chordin"), кажутся частично взаимозаменяемыми. Как и ноггин, хордин обучает клетки становиться спиной, а не животом, нейронами, а не кожей и при этом тормозит сигналы BMP-4, поступающие с противоположной стороны эмбриона. И, подобно мышам с дефектом ноггина, мыши, спроектированные с дефектом гена хордина, также имеют более или менее нормальное геометрическое строение, хотя они и родятся мертвыми. А вот мышам с двойной мутацией, когда повреждены гены и ноггина и хордина, вообще не суждено увидеть белый свет. Эмбрионы двойных мутантов умирают задолго до своего рождения с существенными изменениями геометрии тела. Их можно обнаружить только путем вскрытия материнского организма на ранних стадиях беременности.[31] Результаты экспериментов Хильды Прешельдт были опубликованы в 1924 году, но сама она не дожила до этого момента. На полпути к своей докторской степени она вышла замуж за Отто Мангольда, одного из коллег-аспирантов по лаборатории Шпемана. Под его фамилией она и известна сейчас в науке. В декабре 1923 года после получения степени она родила сына Кристиана и ушла из лаборатории. 4 сентября 1924 года, навещая родителей мужа в Швабии, она пролила керосин, когда разжигала печь. Платье ее вспыхнуло, и на следующий день она скончалась от ожогов. Ей было всего 26 лет, и она была типичным продуктом Веймарской школы. Студенткой, в промежутках между анатомированием эмбрионов, она читала Рильке и Стефана Георге, сидела на лекциях философа Эдмунда Гуссерля, украшала свое жилище репродукциями экспрессионистов и совершала долгие прогулки по Шварцвальду. Она в действительности выполнила лишь одну серию хороших экспериментов, но, по мнению многих, если бы осталась жива, то разделила бы со Шпеманом Нобелевскую премию 1935 года. E pluribus unum?[32] Когда Энг и Чанг совершали турне по Соединенным Штатам, они рекламировали себя девизом, хорошо известным любому жителю республики: "Е pluribus unum" – "В многообразии едины", или "Из множества – один". Это выглядело весьма подходяще, но лишь отчасти было правдой. Сросшиеся близнецы – это прежде всего явный пример обратного: "Ех uno plures" ("Из единого – множество"). Сходство человеческих близнецов со сросшимися близнецами тритона, полученными Хильдой Прешельдт, позволяет понять один из способов того, как это может случиться. Все, что для этого нужно, – два организационных центра у одного эмбриона вместо обычного единственного. Прешельдт удваивала число организаторов у своих тритонов посредством искусной, хотя и несколько жесткой, трансплантационной хирургии. В настоящее время существуют намного более тонкие молекулярные способы добиться того же самого результата. Гены, кодирующие сигнальные белки организатора, – ноггин, цербер, диккопф и так далее, регулируются, в свою очередь, другими, "главными контрольными генами". Тогда появление двух эмбрионов из одного может быть просто результатом включения одного из этих главных контрольных генов, который обычно бывает выключен. Почему это происходит, до сих пор загадка. Сросшиеся близнецы у человека рождаются так редко (около 1 на 100 тысяч живых рождений) и так непредсказуемо, что явных путей к ее разгадке не существует. Может быть, они появляются под действием химических веществ в окружающей среде: было показано, что по крайней мере один препарат (хотя это весьма редкое и мощное химиотерапевтическое средство) вызывает рождение сросшихся близнецов у мышей. Каковы бы ни были окончательные причины появления сросшихся близнецов, теория "двух организаторов", хотя и предлагает довольно-таки убедительное объяснение того, как получить два эмбриона из одного, не может считаться законченным объяснением их существования. Она ничего не говорит об их главной характеристике и не разъясняет способа, которым они, "пришиты" друг к другу.[33] Одним из тех, кто много размышлял о соединении сросшихся близнецов, был Этьен Жоффруа Сент-Илер. В 1829 году Жоффруа был профессором Музея естественной истории и, вслед за Кювье (его коллегой и отчаянным соперником), наиболее известным анатомом Франции. Ученик Жоффруа Этьен Серр написал монографию о вскрытии Риты и Кристины Пароди. Сын Жоффруа, Изидор, организовал само вскрытие. На самом деле именно Изидора подозревали в том, что он заставил чету Пароди отдать труп ученым. Жоффруа-отец слыл одним из самых непредсказуемых умов своего времени: почти все, о чем он писал, носит печать гениальности и абсурдности одновременно. Он был романтиком по своему отношению к природе: по существу ученый-анатом, он изучал способы, посредством которых иглобрюх способен раздувать себя, но не гнушался и глобальных проблем, таких, например, как взаимоотношения "невесомых жидкостей" Вселенной (свет, электричество, нервная энергия и др.). Созданная им в результате этого дедуктивная теория никогда не была опубликована. С большим основанием Жоффруа также активно интересовался уродствами. Именно благодаря его усилиям тератология впервые действительно стала наукой. Сросшиеся близнецы – парапагус дицефалус дибрахиус. Из книги Б.К. Херста и Дж.А. Пирсола "Человеческие уродства", 1893 (Библиотека Уэллком, Лондон). В 1799 году Жоффруа попал в число ученых мужей, которых Наполеон Бонапарт привез в Египет в безнадежной попытке заблокировать англичанам путь на Восток. Жоффруа провел свои египетские каникулы (сокращенные из-за появления на континенте британцев), отлавливая крокодилов, собирая ихневмонов и мумифицированных ибисов. Египет дал ему также возможность упорядочить представления об "уродах". Жоффруа был стойким последователем эпигенеза. Если уродства возникают вследствие неприятных событий, имевших место в утробе, рассуждал он, тогда их можно вызывать искусственно. С незапамятных времен крестьяне долины Нила выводили цыплят в своеобразных инкубаторах, используя для этой цели глиняные печи, в которых они сжигали коровий навоз. Вдохновленный их примером, Жоффруа завел у себя похожую инкубаторную станцию, где занялся тем, что подвергал развивающихся цыплят всевозможным насильственным действиям: встряхивал и переворачивал яйца, протыкал их или покрывал золотой фольгой. В итоге цыплята получались чаще мертвыми, чем изуродованными. Однако у некоторых были искривлены пальцы, клювы, черепа имели странный вид, а еще у нескольких отсутствовали глаза. Довольно-таки неприглядные результаты, но достаточные для того, чтобы убедить Жоффруа, что он окончательно разделался с преформизмом. От уродов-цыплят было легко перепрыгнуть к монстрам человеческим, и начиная с 1822 года Жоффруа публикует серию статей об уродливых младенцах, которых он классифицирует так, как зоологи классифицируют насекомых. Например, ребенок, у которого голова снаружи не видна, принадлежал к роду Cryptocephalus. Жоффруа понимал, что выделенные им "роды" охватывали не только людей: собак, кошек, может быть, даже рыбы могли иметь сходные деформации. Его классификация работала в масштабах всей природы. Через несколько лет Изидор усовершенствует классификацию отца, приведя ее в систему, которой, с которыми модификациями, до сих пор пользуются тератологи. Согласно ей, Рита, Кристина и подобные им дети известны французам как ксифопаги[34], или как сросшиеся близнецы (парапагус дицефалус тетрабрахиус – соединенные боками, двухголовые, четверорукие), – всем остальным. Однако самым грандиозным вкладом Этьена Жоффруа Сент-Илера в тератологию было его представление о том, что уродство – это естественное следствие законов, регулирующих человеческое тело. Более того, такие изуродованные дети могут, при правильном подходе, помочь обнаружить эти законы. Это была, конечно, абсолютно бэконовская идея, и в одном из своих наполненных философским смыслом трактатов французский анатом тепло отзывался о гении лорда-канцлера при короле Якове I. Нигде, по мнению Жоффруа, эти законы не выявлялись с большей очевидностью, чем в сросшихся близнецах. Еще до того, как ему пришлось увидеть Риту и Кристину Пароди в 1829 году, он провел несколько вскрытий сросшихся близнецов. Соединенность, утверждал он, – это просто отражение того, что обычно случается с единичным зародышем. Органы эмбриона развиваются из различных частей, которые затем притягиваются друг к другу загадочной силой, сходной с силой притяжения. Соединение сросшихся близнецов обусловлено той же силой, но неправильно приложенной, в результате чего части близнецов срастаются друг с другом.[35] Жоффруа был в совершенном восторге от своего умозаключения и в свойственном его времени позитивистском духе сформулировал соответствующий закон: le loi d'affinité de soi pour soi – закон сродства подобного с подобным. В монографии Этьена Серра о вскрытии Риты и Кристины первая часть целиком посвящена закону сродства подобного с подобным и некоторым другим закономерностям, сформулированным самим автором.[36] Жоффруа считал закон сродства подобного с подобным своим величайшим открытием и в последующие годы возвел его в ранг фундаментальных закономерностей Вселенной, вполне в духе представлений Гёте об "избирательном сродстве", с которыми он, собственно, и был сходен. Излишняя самонадеянность ученого привела к тому, что сегодня закон сродства подобного с подобным практически забыт. Об этом можно пожалеть, так как хотя закон Жоффруа страдает нечеткостью и ошибочен в деталях, он сообщает нечто важное об устройстве человеческих эмбрионов. Это было первое научное объяснение причин срастания. Соединенность Через восемнадцать дней после зачатия зародыш представляет собой всего лишь белый овальный диск длиной около миллиметра. У него нет органов, только три зародышевых листка и геометрическая структура. Даже эта последняя, в сущности, еще незаметна и выражается посредством молекул, которым уже указали на их место в пространстве и время проявления, но не перевели эти инструкции в нечто такое, что можно было бы увидеть без специальных средств, используемых в молекулярной биологии. В течение следующих десяти дней ситуация коренным образом меняется. В эмбрионе уже можно узнать зарождающегося человека – или, по крайней мере, какое-то будущее позвоночное существо: собаку, курицу, может быть – тритона. У него появляется голова, шея, спинной хребет, кишка, а затем и сердце. Первый признак всех этих будущих сложностей возникает на девятнадцатый день, когда посредине эмбриона над первичной полоской формируется тканевая пластинка, слегка напоминающая удлиненный лист тюльпана. Он не совсем ровный: его края имеют тенденцию заворачиваться к середине, так что на поперечном срезе эмбриона можно увидеть, как он принимает форму уплощенной буквы U. На следующий день U углубляется. Еще два дня – и вертикальные участки этой буквы встречаются в середине эмбриона и касаются друг друга, наподобие того как мотылек складывает крылья. Затем вся конструкция закрывается, будто застегнутая на молнию, и к двадцать третьему дню у эмбриона имеется полая трубка, идущая вдоль почти всей его длины, природа которой теперь совершенно ясна: это зачаток мощного нервного пути, известного под названием спинного мозга. На одном его конце можно даже увидеть закладку мозга. Одновременно с формированием нервного тяжа закладываются основы других органов. С двух сторон образующегося нервного ствола появляются небольшие, похожие на кирпичики кусочки ткани – сначала их единицы, потом десять, двадцать и, наконец, сорок четыре. Состоящие из мезодермы, они огибают нервную трубку, чтобы встретиться с соответствующим номером на противоположной стороне, и в итоге заключают ее в кольцо. Это будущие позвонки, мышцы и глубокие слои кожи. Под эмбрионом эндодерма, выстилающая огромный мягкий желточный мешок, подтягивается внутрь эмбриона и образует кишку. Когда кишка сжимается, две половинки эмбриона, которые прежде были разделены, собираются вместе. Две до того неприметные трубки, по одной с каждой стороны, соединяются и образуют одну, более крупную, идущую по всей длине будущего живота, – абдоминальную трубку, которая является отражением нервной трубки в спинной части. В течение нескольких ближайших дней эта абдоминальная трубка начнет скручиваться – снова и снова, пока не превратится в небольшой механизм изысканного дизайна. Хотя он еще совсем не похож на то, чем потом станет, он уже проявляет такие качества, которые позволили Уильяму Гарвею назвать его "Основой Жизни, Государем Всего Сущего, Солнцем Микрокосма, от которого зависит всякое произрастание и вся Энергия и Сила проистекают". На двадцать первый день он начинает пульсировать. Способность различных зачатков органов находить друг друга и соединяться, образуя целое, – одно из чудес эмбриогенеза, в основе которого лежат тысячи различных молекул, прикрепленных к поверхности клеток и сигнализирующих, как они это и делают, о своей "партийной" принадлежности, что позволяет другим клеткам распознать в них себе подобных. Это молекулы клеточного сцепления. Молекулярные биологи называют их велкро, или липучкой организма[37]: слабые по отдельности, вместе они сильны.[38] При всем этом слияние зачатков органов – дело очень тонкое. Особенно сложно обстоит дело с закрытием нервной трубки. У одного ребенка на тысячу рожденных нервная трубка, хотя бы отчасти, остается открытой – это состояние называется spina bifida (расщелина позвоночника). В самых тяжелых случаях происходит незаращение нервной трубки в будущей голове. Незащищенная нервная ткань при этом некротизируется и отмирает. У таких детей сохраняются остатки ствола мозга, но затылок отсутствует, как будто его снесли топором. Дети-анэнцефалы, как их называют, рождаются в соотношении 1 на 1500. У них тяжелые веки, как будто выпирающие из головы глаза, вываливающийся изо рта язык. Они умирают в течение нескольких дней, если не часов, после рождения. Как явствует из самого названия, spina bifida – не только дефект несрастания нервной трубки, но и сбой в закрытии позвоночного столба, в результате чего спинной мозг остается открытым, без защиты костного футляра. Это не единственный орган, склонный к подобным дефектам. Иногда могут не срастись закладки сердца. Тогда возникает cardiac bifida (расщепленное сердце), или два сердца, каждое из которых представляет половину того, каким оно должно быть.[39] Роль межклеточного сцепления в формировании развивающегося организма поистине удивительна. В монографии о Рите и Кристине Серр описывает пару мертворожденных мальчиков, которые были соединены головами. Сросшиеся в положении живот к животу, с лицами, повернутыми на 90° по отношению к туловищам, они, как двуликий Янус, смотрели в противоположные стороны. Примечательным у этих детей было то, что лицо каждого состояло из половинки лица одного из братьев, слившейся с противоположной половинкой лица другого брата. Зачатки носа, губ, челюстей и мозга у двух младенцев нашли друг друга и гениально соединились – по ошибке сделав это дважды. Сросшиеся близнецы – цефалоторакоилеопаги. Из книги Этьена Серра "Исследования по анатомии трансцендентной и патологической", 1832 (Британская библиотека). Разнообразие способов, с помощью которых сросшиеся близнецы могут соединяться между собой, по-видимому, зависит от взаиморасположения развивающихся зародышевых дисков, когда они плавают в общем зародышевом мешке и соприкасаются друг с другом. Зародышевые диски, из которых образовались Рита и Кристина, располагались бок о бок и срослись вскоре после закрытия позвоночного столба, но до формирования нижнего отдела кишечника. В случае появления близнецов со сросшимися лицами эмбриональные диски располагались голова к голове. Самая крайняя форма сращения близнецов – это случай парапагус дипрозопус, при котором достигается настолько полное слияние, что единственными наружными свидетельствами наличия двух особей может быть частично удвоенный позвоночник, лишний нос или, иногда, третий глаз. На этой стадии всякие дебаты относительно количества индивидуумов в сросшейся паре теряют практический смысл.[40] Сросшиеся близнецы могут превращаться в паразитов, детей, живущих за счет своих братьев или сестер. Вопрос разделения функций в этом случае зависит главным образом от степени асимметрии. Путешествовавший по Европе в 1630-х годах молодой итальянец Ладзарус Коллоредо прославился своим обаянием и хорошими манерами, несмотря на то что прикрепленный к его грудине братец Джон Баптиста бессмысленно болтался спереди. В конце 1800-х годов индийский мальчик Лалу демонстрировал в Соединенных Штатах своего паразита – безымянный безголовый живот с руками, ногами и половыми органами. В 1982 году появились сообщения о тридцатипятилетнем китайце, у которого паразитирующая голова располагалась с правой стороны его собственной головы, у этой добавочной головы был небольшой мозг, два плохоньких глаза, две брови, нос, двенадцать зубов, язык и много волос. Когда основная голова кривила рот, высовывала язык или моргала, то же делала и голова-паразит. Когда основная голова ела, паразит пускал слюни. Усилиями нейрохирургов паразитическую голову удалили. Некоторые части развивающегося организма особенно подвержены появлению паразитов. Среди них нервная трубка, грудина и рот. Описано около сорока случаев рождения детей, у которых карликовые и уродливые паразиты росли прямо на нёбе. Но паразиты сами могут становиться объектом паразитизма. В 1860 году в Дуранго, Мексика, родился ребенок, изо рта которого рос паразит с прикрепленными к нему еще двумя паразитами.[41] Более сложные, внутренние формы паразитизма – это тератомы. Они представляют собой беспорядочные куски тканей, которые, как правило ошибочно, принимают за доброкачественные опухоли. Однако после их удаления хирургическим путем выясняется, что это компактные массы дифференцированных тканей, волос, зубов, костей и кожи. Считали, что появление этих разрастаний связано с нарушениями зародышевых клеток. В отличие от большинства других клеток организма, зародышевые клетки обладают способностью становиться клетками любого типа. Предполагалось, что иногда при попадании в брюшную полость зародышевая клетка, возможно благодаря мутации, дает спонтанное развитие несформированному подобию ребенка. Согласно современным понятиям, тератомы – это, по сути, близнецы, которые полностью помещаются внутри более крупного сибса. Такое состояние получило четкое название "плод внутри плода" ("foetus in foetu").[42] У голландского ребенка, родившегося в 1995 году, были обнаружены в мозге остатки двадцати одного плода (что определили при подсчете ног).[43] Правое – левое Рита и Кристина могут рассказать нам еще об одной проблеме, а именно о том, как мы приобретаем правую и левую стороны. Мы привыкли думать о себе как о симметричных существах и, если смотреть снаружи, таковыми мы и являемся. Конечно, наш бицепс на правой руке может быть развит лучше, чем его аналог слева (или наоборот, что характерно для леворукого меньшинства), и ни один из нас не имеет абсолютно сходных конечностей, глаз или ушей, но это всего лишь мелкие отклонения от основного симметричного плана строения. Внутри, однако, мы не более симметричны, чем улитки. Пульсирующие желудочки нашего сердца отодвинуты в левую часть тела. Там же находятся дуга аорты, грудной лимфатический проток, желудок и селезенка, тогда как полая вена, желчный пузырь и большая часть печени располагаются справа. Внутренние органы Кристины в большинстве своем были локализованы так, как у любого из нас (за исключением печени, сросшейся с аналогичным органом Риты). У Риты, однако, расположение внутренностей было иным – зеркальным отражением органов ее сестры. Сросшиеся близнецы – обратное расположение внутренних органов. Из книги Этьена Серра "Исследования по анатомии трансцендентной и патологической", 1832 (Британская библиотека). Это состояние, известное под названием "situs inversus", в дословном переводе "обратное расположение", обычно для сросшихся близнецов и крайне редко встречается у остальных людей (для которых характерен "situs solitus" – "нормальное расположение"). Не все сросшиеся близнецы демонстрируют situs inversus, но лишь те из них, которые срослись боками (а не головами или бедрами). Но даже среди сросшихся боками близнецов situs inversus встречается только у правостороннего близнеца (под "правой" стороной имеется в виду та, которая является правой для близнеца, а не для наблюдателя), и то всего лишь у 50 процентов особей. Приведенная статистика дает пищу для размышления, так как означает, что то или иное расположение внутренних органов у правосторонних близнецов может встречаться с равной долей вероятности. Как будто природа, определяя положение их внутренностей, отказалась от неуклонного детерминизма, которому подчиняется большинство из нас, и вместо этого бросала жребий – монетку со сторонами "лево" – "право". В последние годы появилось немало данных, почему ориентация наших внутренних органов такая, какой мы ее знаем. Один из источников этих сведений – крайне редкие случаи рождения людей (по максимальным подсчетам, их частота составляет 1:8500), которые, хотя и при отсутствии близнеца, характеризуются обратным расположением внутренних органов. Самым известным в истории человеком, который родился один, но с обратным расположением органов, был старый французский солдат, умерший в Доме инвалидов в 1688 году. Неприметный при жизни, всего лишь один из тысяч, маршировавших по команде Людовика XIV через Фландрию, осаждавших Валансьен и переправлявшихся через Рейн для усмирения германских князьков, он обрел посмертную славу, когда вскрывавшие грудную клетку хирурги обнаружили, что сердце у него находится справа. В XVII веке парижане слагали о нем вирши; в XVIII он фигурировал в "споре о монстрах"; в XIX стал примером "задержки развития" – модной в то время теории.[44] Появись он сегодня на столе патологоанатома, едва ли приобрел бы известность, а был бы просто диагностирован как носитель врожденной аномалии, называемой синдромом Картагенера. Этот диагноз позволяет нам реконструировать некоторые подробности истории болезни старого солдата. Хотя непосредственная причина его смерти неизвестна, она наверняка не имеет ничего общего с обратным расположением его органов. В действительности он, по всей вероятности, даже не подозревал об особенностях своего внутреннего строения. Хотя он был вполне здоров (и умер в почтенном возрасте 72 лет), он, наверное, никогда не имел детей и отличался, скорее всего, очень плохим обонянием. Мы можем высказать такие догадки, потому что перевернутое расположение органов, бесплодие и слабое обоняние характеризуют мужчин с синдромом Картагенера. Синдром Картагенера. Препарированный труп младенца с обратным расположением внутренних органов. Из книги Жоржа Леклерка Бюффона "Естественная история: всеобщая и частная", 1777 (Библиотека Уэллком, Лондон). То, что связь между подобными симптомами вообще была замечена, не может не вызвать изумления – настолько разрозненными кажутся эти признаки. И даже после того как синдром был впервые описан в 1936 году, причинная связь между его характерными чертами оставалась скрытой на долгие годы. Но вот в 1976 году шведский врач по имени Бьорн Афцелиус обнаружил, что плохое обоняние и бесплодие вызываются дефектом ресничек – мельчайших образований, которые выступают на поверхности клеток и производят движения наподобие миниатюрных весел. Реснички удаляют ненужные частицы из бронхиальных путей; хвост, с помощью которого сперматозоид достигает своего назначения, – это также всего лишь большая ресничка. Каждая ресничка управляется молекулярным мотором, который у людей с синдромом Картагенера не работает. В детском возрасте из-за неспособности ресничек очищать дыхательные пути и синусы у таких детей развиваются бронхиты и синуситы и, как следствие, плохое обоняние. Во взрослом состоянии мужчины страдают бесплодием из-за отсутствия подвижной спермы. В основе молекулярного мотора лежит большой белковый комплекс, называемый динеином. Он состоит из десятка с лишним менее крупных белков, каждый из которых кодируется одним геном. Пока что для синдрома Картагенера выявлены мутации по крайней мере двух из этих генов, и можно выразить твердую уверенность, что вскорости будут обнаружены и другие.[45] Но наибольший интерес вызывает как раз situs inversus. Афцелиус заметил, что не для всех людей с синдромом Картагенера характерно обратное расположение внутренних органов, а, как и для сросшихся близнецов, только для половины. На основе этого наблюдения он высказал весьма проницательную мысль о том, что реснички представляют собой важную часть механизма, используемого зародышем для отличия левой стороны от правой. Однако в чем именно заключается их роль, ученый объяснить не смог. Лишь в последние несколько лет было обнаружено основное связующее звено, хотя и сейчас многое остается неясным. Все опять-таки связано (что неудивительно) с организационным центром. Выше я уже говорил, что организатор – это группа мезодермальных клеток, расположенных на одном конце зародышевой первичной полоски. Каждая из таких клеток имеет одну-единственную ресничку, которая постоянно движется в направлении справа налево. Взятые вместе, все реснички производят слабое, но, как видно, крайне важное течение в окружающей зародыш жидкости, своего рода амниотический Гольфстрим. Это движение имеет направление, и реснички, чья неустанная деятельность служит его причиной, – первый признак того, что левое и правое для зародыша не одно и то же. Этот механизм, обнаруженный только в 1998 году, восхитительно прост и, насколько сейчас известно, не используется при формировании эмбриона больше нигде. Что в действительности делают реснички, пока неясно; наиболее верное предположение на сегодняшний день состоит в том, что они собирают какие-то сигнальные молекулы с левой стороны эмбриона, подобно тому как пена скапливается в речных водоворотах.[46] Эта модель (с ее аристотелевским подтекстом) чисто спекулятивна, но она приобретает смысл в свете того, что происходит далее. Вскоре после формирования организатора можно наблюдать, как в окружающих его клетках слева и справа включаются гены. Они кодируют сигнальные молекулы, которые передают зачатки асимметрии, изначально установленной бьющимися ресничками организатора, остальному эмбриону и усиливают ее. Подобную ситуацию можно было бы сравнить с сигнальным реле, не покажись это выражением слишком большой согласованности. Скорее все напоминает ожесточенную предвыборную кампанию. При демократических режимах правые и левые силы борются за сердце полиса. Так же обстоит дело и с эмбрионом. Доказательством этого служит один изящный эксперимент. Если различные сигналы, возникающие на ранних стадиях жизни эмбриона на той или другой стороне организатора, в действительности помогают ему отличать левое от правого, тогда можно запутать эмбрион, поменяв стороны действия сигналов. Как всегда, этот трюк тяжело выполнить на зародышах млекопитающих и гораздо легче – на куриных. Осторожно разрезав только что отложенное куриное яйцо и обнажив тем самым эмбрион, лежащий на желточной подстилке, можно аккуратно поместить кремниевый шарик, смоченный в "левостороннем" сигнале, направо (или поместить шарик, смоченный в "правостороннем" сигнале, налево). Так или иначе, но асимметрия сигналов эмбриона будет нарушена. То же, как выяснится вскоре, произойдет и с асимметрией сердца цыпленка. Если прежде оно всегда тяготело к левой стороне, то теперь с равной вероятностью может оказаться и на той и на другой стороне. Сходство этой ситуации с тем, что наблюдается у людей с синдромом Картагенера или у сросшихся близнецов, конечно, не случайно. И в самом деле, принято считать, что перевернутое расположение сердца Риты было вызвано именно таким перепутанным молекулярным сигналом. Когда девочки были не чем иным, как лежащими бок о бок первичными полосками, каждая пыталась сформировать свою собственную пространственную геометрию. Но в Ритином случае эти усилия были нарушены сигналами, исходящими от ее левостороннего близнеца. Молекулярные асимметрии, от которых зависела ее будущая структура, были отменены, и с этого момента с вероятностью пятьдесят на пятьдесят сердце Риты могло переместиться на неположенную сторону.[47] В 1974 году Клара и Альтаграсиа Родригес стали первой парой сросшихся близнецов, которым успешно провели хирургическую операцию по их разъединению. С тех пор появление на свет каждой новой пары: Мпхо и Мпхоньяны (родились в 1988 году в Южной Африке), Кейти и Эйлиш (родились в 1989 году в Ирландии), Анджелы и Эйми (родились в 1993 году в США), Джозефа и Луки (родились в 1997 году в Южной Африке), Марии-Тересы и Марии-де-Хесус (родились в 2002 году в Гватемале) – здесь приведена лишь небольшая часть списка, – становилось поводом для мини-драмы, в которой участвовали хирурги, судьи и родители, выполнявшие роль царя Соломона. Несмотря на все достижения хирургии, Рита и Кристина Пароди, родись они сегодня, не могли бы быть разделены. Но они наверняка выжили бы. Где-то в Америке обитают Британи и Абигейл Хенсел. Им, близнецам, сросшимся еще теснее, чем Рита и Кристина, недавно минуло двенадцать. Жюль Жанен так и не написал своего романа о непрожитых жизнях Риты и Кристины Пароди. Но он оставил наброски. Никакой перевод не сможет полностью передать неистовство его прозы, но пересказ все же даст о ней некоторое представление. В мире Жанена нет ни слова о том, что девочки родились в бедности (в конце концов, "нищета губит все, к чему прикасается"), напротив, их семья довольно состоятельна. У них также по необъяснимой причине разного цвета волосы. Кристина – белокурая, сильная и великодушная, ласково опекает свою более слабую и слегка мрачноватую сестру, которая, конечно же, оказывается брюнеткой. Царит полная гармония, но вот проходит их семнадцатая весна, и на пороге появляется l'Amour в образе скромного Вертера, который любит только одну из сестер и любим ею – разумеется, это Кристина. Ах, какая интрига! Две женщины, одно сердце, один возлюбленный. Слишком трагично, чтобы выразить словами. Рита заболевает, и начинается яростная борьба между жизнью и смертью, как "у смертельно раненного солдата". Сестры испускают дух, и мы оставляем их, по словам Жанена, "с чувством некоторого ужаса, с неизведанными эмоциями" и с несказанным облегчением оттого, что автор так никогда и не закончил своего романа. В реальности, конечно, все было абсолютно по-иному. Когда Серр разделался с Ритой и Кристиной, он сохранил не только их скелет, но и довольно много частей тела. В старом каталоге Музея естественной истории каллиграфическим почерком перечислено поступление отдельных образцов мозга детей (кат. № 1303 и 1304), глаз (1306, 1307), языка (1308, 1309) и некоторых других остатков. Большая часть этих экспонатов к настоящему времени, по-видимому, потеряна, хотя не исключено, что однажды они всплывут на поверхность из подземных хранилищ музея. Однако скелет Риты и Кристины можно увидеть и сейчас – как и раскрашенный гипсовый слепок с их тела. Оба эти экспоната выставлены для обозрения в Галерее сравнительной анатомии – помещении со стальными сводами и интерьером, напоминающим собор изящных искусств, которое находится на расстоянии каких-нибудь нескольких сотен метров от того амфитеатра, где проводилось вскрытие девочек. Галерея сравнительной анатомии может показаться довольно-таки странным местом для демонстрации останков двух маленьких девочек. Почти все из сотен находящихся здесь других скелетов принадлежат животным, экспонированным по их принадлежности к тому или иному отряду, семейству, роду и виду. И все же, если посмотреть с другой точки зрения, для Риты и Кристины трудно было бы отыскать лучшее место. Галерея представляет собой продукт совместных усилий величайших естествоиспытателей Франции по наведению порядка в мире природы, отысканию должного места для каждого вида и пониманию значения всех видов в построенной системе природы. Этьен Жоффруа Сент-Илер рассматривал изучение врожденных уродств совершенно в этом же ключе – в первую очередь как проблему классификации сросшихся близнецов во всеобщем порядке вещей. По чьей-то воле останки Риты и Кристины – и это наверняка бы понравилось Жоффруа – находятся в витрине вместе с парочкой поросят и парочкой цыплят, сросшихся, как и сами девочки. Такие экспонаты были для него самым ярким доказательством того, что уродства не случайны, не каприз природы или космическая шутка, а, скорее, результат естественных сил, которые доступны для понимания. "Уродов не существует, – утверждал он, – природа едина".[48] Как часто бывает с французскими афоризмами, этот довольно загадочен. Однако, стоя перед витриной, содержащей то, что осталось от Риты и Кристины Пароди, и глядя на розоватый гипсовый слепок с их тела, на две белокурые головки и четыре голубых глаза, легко понять, что именно имел в виду Жоффруа. Глава III Страшный суд [об основных частях] Циклопия Мертворожденный младенец из Фирме, Италия, 1624 г. Из книги Фортунио Лицети "О происхождении, природе и разновидностях уродов", 1634 (Библиотека Уэллком, Лондон). В 1890 году граждане Амстердама купили анатомическую коллекцию Виллема Фролика за сумму 12 тысяч гульденов. Она состояла из 5103 предметов, в числе которых были такие раритеты, как череп принца Суматры по имени Депати-тутуп-хура, восставшего, очевидно без малейшей надежды на успех, против своих колониальных хозяев. Там были также череп кита нарвала с двумя клыками, некогда принадлежавший датской королевской семье, коллекция человеческих черепов, представлявших разные народы мира, и останки 360 людей с различными врожденными пороками: среди них были скелеты взрослых людей, но в основном – младенцы, сохранявшиеся в спирте или формалине. Собрание Фролика было лишь одной из больших тератологических коллекций, составленных в течение XVIII и XIX столетий. В лондонской больнице Гайз и Сент-Томас хранится коллекция Гордона, в Королевском колледже врачей и хирургов – Хантеровская; Филадельфия славится Мюттеровской коллекцией; Париж известен той, что хранится в Музее естественной истории, а также собраниями Орфила и Дюпюитрена. Коллекция Фролика, переданная медицинскому факультету Амстердамского университета, теперь занимает светлую галерею в здании современного биомедицинского комплекса, возведенного на окраине города. Ее необычность и даже уникальность состоит в ее доступности. В то время как большинство тератологических коллекций закрыты для всех, кроме врачей и ученых, кураторы Фроликовского собрания открыли его для публики. Демонстрируя яркий пример голландского рационализма, они решили, что всякому, кто того пожелает, должно быть дозволено увидеть худшее своими глазами. И это "худшее" на самом деле ужасно. Выставленные в застекленных витринах, экспонаты Фролика действительно имеют весьма устрашающий вид. Раззявленные рты, незрячие глаза, раскрытые черепа, рассеченные животы и сросшиеся или отсутствующие конечности выглядят как последствия взрыва ни с чем не сравнимой силы, будто некий невидимый Ирод только что учинил новое избиение невинных. Многие из собранных Фроликом младенцев родились мертвыми. Скелет новорожденного со лбом в форме дыни представляет собой случай летальной скелетной дисплазии (Thanatophoric dysplasia)[49]; другой младенец с обрубками конечностей, прижатыми к стенкам сосуда, внутрь которого его поместили, демонстрирует хондродисплазию Бломстранда. Вот витрина с останками детей, являющих примеры острых нарушений в сращении нервной трубки. Их спины расщеплены, а мозги вываливаются из черепов. По другую сторону галереи выставлена серия сросшихся близнецов. У одной пары близнец-паразит, величиной не уступающий своему хозяину, вырастает у него прямо изо рта. Рядом с ними экспонат, обозначенный как "акардия аморфус" ("acardia amorphus")[50], – покрытый кожей шар, ничем не напоминающий ребенка, которым он мог бы стать, за исключением небольшого пупочного канатика, кусочка кишечника и рудиментарного позвоночного столба. Невозможно представить себе границы разнообразия человеческих форм, пока не пройдешься по залам, где размещены коллекции наподобие Фроликовской. Единственное, с чем можно сравнить увиденное, по крайней мере по визуальному впечатлению, – так это с демоническими созданиями, резвящимися на картинах еще одного голландца – Иеронима Босха, которые находятся сейчас в разных музеях мира. Конечно, смысл их различен. В то время как гротески Босха призваны предупредить заблудшее человечество о той судьбе, что ожидает его после смерти, фроликовские уродцы представлены с медицинской беспристрастностью, и их экспозиция лишена морального подтекста. В этом-то, наверное, и заключена наилучшая характеристика Музея Фролика. Страшный суд эпохи научного познания.[51] Циклопы Из всех опубликованных трудов Виллема Фролика самым великим является фолиант, выпущенный им между 1844 и 1849 годами и названный "Таблицы для иллюстрации эмбриогенеза человека и животных в норме и в аномалиях". Содержащиеся в нем литографии на тератологические темы выполнены с таким совершенством и достоверностью, которые и по сей день поражают воображение. Самые роскошные иллюстрации в этой книге посвящены плодам человека и животных, которые вместо двух глаз имеют только один – единственное око, расположенное посередине лба. К тому моменту, когда Фролик занялся написанием "Таблиц", он уже изучал это патологическое состояние в течение десяти лет, опубликовал о нем фундаментальную монографию и собрал коллекцию из двадцати четырех образцов: восьми поросят, десяти ягнят, пяти младенцев и котенка, у которых это нарушение присутствовало с разной степенью тяжести. Вслед за Жоффруа он назвал это явление именем одного из самых ужасных созданий греческой мифологии – циклопа.[52] Гесиод говорит, что существовало три циклопа – Бронт, Стероп и Арг и все они являлись потомками Урана и Геи. Это были гигантские, чудовищные создания, которые, согласно одним описаниям, ковали Зевсу громы и молнии, а по другим – строили стены Микен. В "Одиссее" циклопы приобрели больше человеческих черт и стали более многочисленными, чем в "Теогонии", но их единственный глаз по-прежнему оставался признаком дикости. Гомер называет их необузданными. Самый необузданный из них – Полифем: ему нравится человеческая плоть, и, до того как съесть товарищей Одиссея живьем, он выколачивает из них мозги: "...как щенков, их ударил об землю". Гомер не называет остров, где жил кровожадный циклоп, но Овидий поселяет его на склонах Этны на Сицилии и наделяет трогательной, хотя и маниакальной страстью к нимфе Галатее. Изображенный на вазах, отлитый в бронзе и высеченный из мрамора, Полифем у греков, как правило, сбрасывал камни на корабли Одиссея или корчился в агонии, после того как тот вонзил пылающий кол в его единственный глаз.[53] Многие тератологи искали связь между уродством и мифом. Они доказывали, что иконографической моделью для чудовища-полубога мог быть человеческий младенец. Конечно, модель, если она когда-нибудь и существовала, оставила по себе довольно-таки расплывчатые воспоминания. Не говоря уж о различиях в размерах и силе, даже в самых ранних изображениях Полифема его единственный глаз помещен туда, где ему и следовало находиться, – над носом циклопа. Но единственный глаз ребенка-циклопа всегда располагается под его носом – или под тем, что от того осталось. Другие утверждали, с большей или меньшей степенью правдоподобия, что появление мифа о циклопах связано с наполовину окаменелыми останками карликовых слонов, которыми изобилуют средиземноморские острова.[54] Циклоп, преследующий Галатею. Из книги Блеза де Виженера "Образы Филострата", 1624 (Британская библиотека). Каково бы ни было их происхождение, от Гомера до Фролика иконография циклопов показывает четкую эволюционную преемственность. Гомеровский Полифем ужасен; у Овидия он остается таким же, но приобретает черты сентиментальности. Однако уже через шестьдесят лет после смерти поэта, последовавшей в 17 году н.э., циклопы появляются в совершенно ином обличии. Они становятся расой существ, имеющих онтологический статус, который подтверждается авторитетными путешественниками и философами. В 77 году н.э. Плиний Старший закончил свою энциклопедическую "Естественную историю". Основываясь на текстах более ранних греческих писателей, таких как Мегасфен, который около 303 года до н.э. отправился послом в Индию по следам завоеваний Александра Великого, Плиний населил Индию и Эфиопию (которые в его представлении едва различались между собой) множеством мифических рас. Там были сциаподы с одной огромной ногой, которой они при необходимости пользовались как зонтиком; карликовые пигмеи; собакоголовые циноцефалы; люди без головы, но с глазами между лопаток; люди с восемью пальцами на каждой руке; люди, которые жили по тысяче лет; люди с огромными ушами и люди с хвостом. Наконец, там были и одноглазые люди: Плиний называет их аримаспами и рассказывает, что они сражаются с грифонами за золото.[55] Так было положено начало традиции в описании мифологических рас, просуществовавшей около пятнадцати столетий. К III веку н.э. эту традицию переняли христианские авторы. В V веке Святой Августин задается вопросом, все ли расы ведут начало от Адама. В Средние века в рукописных книгах о чудесах вроде "О природе вещей" Фомы из Кантемпре, сочиненной около 1240 года, циклопы предстают, по существу, не изменившимися со времен античности. XIV столетие устанавливает их библейские корни: они – уродливые потомки Каина и Хама. Примерно в то же время они появляются в миниатюрах, иллюстрирующих путешествия Марко Поло (сам итальянец странным образом не упоминает об их существовании). В начале XVI века один из циклопов возникает на стене датской церкви в полосатых штанах, мягкой шляпе и с кожаным кошельком – как и подобало выглядеть денди из Балтии в конце Средневековья. Со временем циклопы мельчают, становятся ручными и поселяются вблизи жилищ человека. Первое изображение ребенка с циклопией, отличного от мифических циклопов, приводит Фортунио Лицети в своем труде "О происхождении, природе и разновидностях уродов", изданном в 1634 году. Он описывает младенца-девочку, родившуюся в Фирме, Италия, в 1624 году, у которой, по его словам, было нормально устроенное тело и ужасно уродливая голова. Посредине лица на месте носа у нее располагалась масса разросшейся кожи в виде пениса или груши, а ниже находился квадратный участок красноватой кожи с двумя близко посаженными, как у курицы, глазами.[56] Хотя девочка умерла при рождении, на рисунке она изображена с пропорциями крупного десятилетнего ребенка, в полном соответствии с размерами предшественников-гигантов. Лицети описывает еще один случай циклопии, на этот раз у парочки сросшихся близнецов, черепа которых соединились таким образом, что лица детей смотрели в разные стороны, поистине напоминая двуликого Януса. Срастание близнецов и циклопия – необычное сочетание аномалий, и можно было бы усомниться в достоверности этого сообщения, если бы в 1916 году не появилось клиническое описание пары сросшихся близнецов, демонстрировавших в точности такую же комбинацию патологических признаков.[57] Кроме того, рисунок Лицети отличался необычным происхождением. По словам автора, это была копия изображения, сохранившегося в коллекции его высокопреосвященства досточтимого кардинала Барберини в Риме, оригинал которого, ныне, по-видимому, потерянный, принадлежал кисти Леонардо да Винчи.[58] Циклопия у сросшихся близнецов. Рисунок приписывается Леонардо да Винчи. Из книги Фортунио Лицети "О происхождении, природе и разновидностях уродов", 1634 (Библиотека Уэллком, Лондон). Глядя на своих заспиртованных младенцев, Виллем Фролик определил, что у некоторых уродство было выражено сильнее, чем у других. У одних имелся лишь один-единственный глаз, спрятанный внутри глазницы, у других были видны два глазных яблока. У одних был заметен нос, у других его вовсе не было. Современные клиницисты считают циклопию одним из крайних проявлений в спектре уродств головы. На другом конце спектра находятся люди, единственная аномалия которых состоит в том, что одиночный резец, вместо обычных двух, расположен у них в центре верхней челюсти. Единственный глаз ребенка-циклопа – внешний признак нарушения, проникающего вглубь черепа. У всех нормальных позвоночных мозг разделен на две части. Мы со всей очевидностью обладаем левым и правым полушариями большого мозга, которые активизируем, в том числе и тогда, когда говорим о "левом" и "правом" мозге. У детей-циклопов разделения нет. Вместо двух отдельных мозговых полушарий, двух зрительных и двух обонятельных долей части их переднего мозга срослись в явственно неделимое целое. Действительно, клиницисты называют весь спектр этих врожденных аномалий серией голопрозенцефалических нарушений, от двух греческих слов: holo – целое, prosencephalon – передний мозг. Во всех своих проявлениях это самая распространенная аномалия мозга у человека, встречающаяся с частотой 1 на 16 тысяч живых рождений или 1 на 200 выкидышей.[59] Простота, с которой плод может стать циклопом, пугает. Эмбрионы рыб приобретают циклопические характеристики, если их нагревают, охлаждают, облучают, лишают кислорода или подвергают воздействию эфира, хлороформа, ацетона, фенола, масляной кислоты, хлорида лития, ретиноевой кислоты, алкоголя или просто поваренной соли. В 1950-х годах в Соединенных Штатах разразилась эпидемия рождений ягнят-циклопов, которая была вызвана тем, что беременные овцы паслись на лугах, где росли полевые вьюнки, растения субальпийской зоны, листья которых богаты токсичными алкалоидами.[60] У людей страдающие диабетом матери имеют в 200 раз больший риск родить ребенка-циклопа, так же как и матери-алкоголички. Циклопия. Мертворожденный теленок. Из книги Виллема Фролика "Таблицы для иллюстрации эмбриогенеза человека и животных в норме и в аномалиях", 1844-1849 (Библиотека Уэллком, Лондон). Однако большинство случаев циклопии вызваны не тем, что делали (или чего не делали) матери во время беременности. Мутации, по минимуму в четырех, а по максимуму, возможно, в двенадцати человеческих генах, также могут стать причиной состояния голопрозенцефалии. Один из этих генов кодирует сигнальный белок под названием соник-хеджхог, или соник-ежик. Эта молекула получила свое название в начале 1980-х годов, когда была обнаружена мутантная мушка дрозофилы, личинки которой имели избыточное количество щетинок, покрывающих все их малюсенькое тельце. Ежик – подходящее название для такого гена, а когда соответствующий ген был обнаружен и у позвоночных, аспирант, который наверняка обожал свою игровую приставку, не нашел лучшего названия, чем соник-ежик[61]. Мутации гена соник-хеджхог (sonic-hedgehog), вызывающие циклопию у человека, являются доминантными. Это означает, что всякий, имеющий единственную копию дефектного гена, будет обладателем циклопии или, по крайней мере, некоторого вида голопрозенцефалии. Однако, по не вполне понятным причинам, некоторые носители мутантных генов не проявляют никаких аномалий. Они живут и передают ущербные гены своим детям.[62] Циклопия. Мертворожденный младенец. Из книги Б.К. Херста и Дж.А. Пирсона "Человеческие уродства", 1893 (Библиотека Уэллком, Лондон). Тот факт, что у детей с мутацией соник-хеджхога присутствует одно-единственное полушарие, говорит о многом. У нормального эмбриона передний мозг формируется как единое образование – простая выпуклость на конце нервной трубки, и лишь позднее он делится на левый и правый передний мозг. Это разделение индуцировано соником, который, подобно многим другим сигнальным молекулам, является морфогеном. Во время формирования нервной трубки соник появляется в небольшом участке мезодермы, непосредственно под развивающимся передним мозгом. Проникая из одной ткани в другую, он расщепляет мозг на две части. Этот процесс особенно очевиден при формировании глаз. Задолго до того, как у эмбриона появляются глаза, в переднем мозге возникает зона, предназначенная для их нейронного обеспечения. Эта область – зрительное поле – впервые появляется в виде единого ободка, пересекающего передний мозг. Соник меняет топографию зрительного поля, разделяя его на два меньших по площади участка, локализованных по обе стороны головы. Мутации или воздействие химических веществ, ингибирующих соник, препятствуют этому – так возникает единственный, уродливый, выпученный глаз ребенка-циклопа.[63] Но соник делает еще кое-что, помимо того, что дает нам раздельные полушария. Мыши, у которых ген соник-хеджхога полностью выключен, характеризуются аномалиями сердца, легких, печени и кишок. Они всегда рождаются мертвыми и не имеют лапок. Их мордочки изуродованы пострашней, чем у циклопов, превращаясь в странное подобие туловища: у них нет глаз, ушей или ртов.[64] Эти пороки развития означают, что соник широко используется в эмбриогенезе, почти повсюду, где имеются растущие части. Он даже как будто используется повторно при формировании наших голов. Эмбрионы диких мышей и мышей с дефектами соник-хеджхога. Чин Чанг (Медицинский центр Вандербильта) Лицо зародыша формируется из пяти бугорчатых возвышений, которые поначалу вполне различимы, но впоследствии срастаются друг с другом. Два из них превращаются в верхнюю челюсть, два – в нижнюю, а из одного, переднего, формируются нос, фильтр[65] и лоб. Эти пять возвышений секретируют белок соник-хеджхог. Соник, в свой черед, контролирует их рост и тем самым план строения лица. Или, точнее, он регулирует его ширину, устанавливая расстояние между нашими ушами, глазами и даже ноздрями. Мы знаем это, потому что у куриных эмбрионов, в лицевой отдел которых вводятся дополнительные дозы соника, образуются необычно широкие "физиономии". Если дозу увеличить еще больше, то лицевая поверхность разрастается настолько, что на ней начинают появляться дублирующие структуры, так что в итоге образуется два клюва, сидящие бок о бок. Что-то похожее происходит естественным путем и у человека. Некоторые генетические нарушения характеризуются чрезвычайно широко расставленными глазами – признак, известный под названием гипертелоризма. Одно из таких состояний вызвано мутацией гена, который обычно ограничивает активность соника. Больные, страдающие другой формой гипертелоризма, даже напоминают цыплят, которым вводили дополнительные дозы соника, – у них очень широкие носы, или носы с двумя кончиками, или вообще по два носа. Глядя на такого рода нарушения, естественно спросить, насколько широкими вообще могут быть лица. Если, по мере того как лицо становится все шире и шире, отдельные его части начинают удваиваться, может ли индивид в конечном итоге заполучить два идентичных лица-дубликата – и будут ли это два индивида? Вопрос отнюдь не академический. Один родившийся в Айове поросенок пришел в этот мир с двумя мордами, двумя пятачками, двумя языками, двумя пищеводам и тремя глазами, каждый из которых был присоединен к собственному зрительному нерву. Возможно, он начинал свое развитие как парочка зародышей близнецов, которые в дальнейшем срослись удивительно тесным образом. Но исходя из того, что удвоение касалось только лицевой части и переднего мозга, можно также предположить, что поросенок сформировался из единого зачатка эмбриона, но с очень широкой головой. Законсервированная в сосуде голова поросенка хранится в Калифорнийском университете в Сан-Франциско и представляет собой подходящий объект для философских размышлений. Один это поросенок или два? Вопрос поставил бы в тупик самого Фому Аквинского. Но не ученых, которые ухаживали за животным. Не обращая внимания на метафизику, они удвоили свои усилия и назвали друга (или друзей) Дитто.[66][67] Удвоение лицевой части у поросенка Дитто. Джилл Хелмс (Калифорнийский университет, Сан-Франциско). Сирены Среди уродств, с регулярностью появляющихся в больших тератологических коллекциях – у Фролика, например, на них отведена целая витрина, – особое место занимает синдром под названием "сиреномелия". Название образовано из слов сирена – так звали созданий, соблазнявших Одиссея, и мелия – конечность. Английское название "mermaid syndrome" – "синдром русалки" – не менее выразительно. Вместо двух крепких ног у детей с сиреномелией вырастает только одна нижняя конечность, да и та в виде сужающегося к концу отростка, содержащего одну бедренную кость, одну большую и одну малую берцовые кости. Более всего они напоминают тех фальшивых русалок, которых японские рыбаки изготовляли в XIX веке из высушенных останков обезьян и рыб. Циклопию и сиреномелию объединяет нечто большее, чем отзвуки гомеровских текстов. Как при циклопии нарушения связаны со средней линией лица и выражаются в невозможности двух сторон отъединиться друг от друга на достаточно большое расстояние, так при сиреномелии то же нарушение происходит по средней линии нижних конечностей. У младенца с сиреномелией нет ни левой, ни правой ноги, а есть пожалуй что две ноги, которые каким-то образом срослись вместе.[68] Сиреномелия, или синдром русалки, у мертворожденного плода. Из книги Б.К. Херста и Дж.А. Пирсола "Человеческие уродства", 1893 (Библиотека Уэллком, Лондон). Причины возникновения сиреномелии до сих пор полностью неясны. Но недавно две группы ученых независимо друг от друга вывели с помощью генетической инженерии штамм мышей с дефектом по одному конкретному гену. Неожиданно оказалось, что у новорожденных мышей не было хвостов, а задние конечности срослись, в точности как у детей с сиреномелией. По всем признакам это были мыши-русалки. Мыши-русалки появились в результате делеции гена CYP26A1, который кодирует фермент, регулирующий вещество под названием "ретиноевая кислота".[69] Большинство важных молекул, контролирующих процесс формирования эмбриона, иначе говоря – часть генетической грамматики организма, – это белки, представляющие собой длинные цепи аминокислот. Однако ретиноевая кислота является более мелкой и простой разновидностью молекул, представленной всего лишь углеводородным кольцом с боковой цепью. Это также одна из наиболее загадочных зародышевых молекул. Она трудна для изучения из-за своей небелковой природы. Во-первых, ее нельзя увидеть у эмбриона. Специальные красители, используемые для наблюдения за белками, в случае углеводородного кольца не работают. Во-вторых, раз она не белок, не существует "гена ретиноевой кислоты", или единой цепочки ДНК, которая непосредственно кодировала бы информацию, необходимую для ее получения. Существуют лишь гены, кодирующие ферменты, которые вырабатывают ретиноевую кислоту или разрушают ее, – до обидного непрямая связь между геном и веществом. Но даже и в этом случае уже давно возникали подозрения, что ретиноевая кислота играет важную роль. Эмбрионы вырабатывают свою ретиноевую кислоту из витамина А. Необходимость в этом веществе стала ясна еще в 1932 году, когда свиноматка, содержавшаяся в Техасском сельскохозяйственном колледже и получавшая диету с дефицитом витамина А, родила одиннадцать поросят с отсутствием глазных яблок.[70] С другой стороны, последствия избытка ретиноевой кислоты выявились в 1980-х годах, когда сходное по молекулярному составу вещество – изотретиноин – стали интенсивно прописывать для лечения прыщей-акне. Лекарство принимали через рот, и, хотя его тератогенное воздействие к тому времени было уже установлено, некоторые женщины продолжали пользоваться препаратом на ранних стадиях беременности из-за того, что еще не подозревали о своем материнстве. В одном исследовании были изучены результаты тридцати шести таких беременностей: двадцать три ребенка родились внешне нормальными, восемь беременностей закончились выкидышами, пять детей родились с аномалиями, в том числе с волчьей пастью, нарушениями сердца, центральной нервной системы и отсутствием ушей.[71] Некоторые ученые пытались повторить этот незапланированный эксперимент, окуная зародыши животных в ретиноевую кислоту, а потом отслеживая деформации. Часто в результате возникала смесь различных нарушений, примерно так, как это было у младенцев, подверженных воздействию изотретиноина. Но иногда последствия были более впечатляющими. Если головастику ампутировать хвост, то обычно у него в короткое время вырастает другой. Но если хвост ампутировать и культю помазать раствором ретиноевой кислоты, то у головастика вырастет букет из лишних ног. Этот эксперимент отчетливо показывает, что ретиноевая кислота – мощное средство. Он также позволяет предположить, что головастики могут использовать ретиноевую кислоту для регуляции своих задних отделов. Однако это еще не есть доказательство. Можно возразить, что ретиноевая кислота является, по существу, экзотическим видом отравляющего вещества, которое совершенно неестественным образом влияет на нормальный ход эмбрионального развития. В этом и заключается значение мышей-русалок. Они впервые позволяют реально понять, для чего зародыши используют ретиноевую кислоту. Видимо, это морфоген, причем один из самых важных для эмбриона. Действительно, его можно даже назвать супер-морфогеном, который действует и вдоль и поперек эмбриона. Будучи углеводородным кольцом, он, однако, действует абсолютно отлично от других морфогенов. В то время как молекулы сигнальных белков слишком велики, чтобы проникнуть в клетку, и поэтому прикрепляются к рецепторам на ее поверхности, ретиноевая кислота проходит сквозь клеточные мембраны и присоединяется к рецепторам внутри клетки, которые внедряются прямо в ядро, где они включают или выключают гены. Откуда берется ретиноевая кислота? И что она в точности делает? Ген CYP26A1 кодирует фермент, который разрушает ретиноевую кислоту. Мыши с дефектом этого гена имеют слишком большое количество ретиноевой кислоты. Их русалочьи конечности вызваны аномальным избытком этого вещества в задней части зародыша. Задний отдел эмбриона – это не единственное место, подверженное воздействию высоких концентраций ретиноевой кислоты. Дети и мыши с сиреномелией также характеризуются дефектами головы, из чего следует, что ретиноевая кислота в норме там тоже отсутствует. Действительно, сегодня принято считать, что если изобразить, как ретиноевая кислота распределяется по всему зародышу, то получится следующий график: пик в районе будущей шеи эмбриона с дальнейшим падением градиента во всех направлениях – в разные стороны, вперед и назад. Это модель тщательно сконструированной пространственной структуры, которая поддерживается равновесием ферментов, создающих и разрушающих морфоген. У лягушек с лишними ногами, мышей-русалок, детей с сиреномелией и плодов, пострадавших от воздействия противоугревых препаратов, этот баланс нарушен, так что вместо подъемов и спадов остается только плохо определяемое плато.[72] Калькулятор судьбы Морфогены, пронизывающие развивающийся эмбрион, будь то белки или углеводородные кольца, снабжают клетки своеобразной координатной сеткой, которой те пользуются, чтобы определить, где находятся и, следовательно, что они должны делать и кем стать. Клетка, таким образом, напоминает мореплавателя, который бороздит пучины океана и с помощью секстанта и хронометра определяет долготу и широту. Но между мореходом и клеткой есть одна большая разница: в то время как ориентиры первого – звезды и планеты – всегда находятся там, где им и следует быть, в случае с клеткой дело подчас обстоит по-другому. Сиреномелия и циклопия – это примеры того, как мутация видоизменяет вселенную, по которой ориентируются клетки, или вообще приводит к ее полному краху. И все же, несмотря на это различие (неизбежно возникающее при сравнении физического мира с его точными, как у часового механизма, движениями и биологических объектов, построенных, в полном смысле слова, на живую нитку), аналогия по-прежнему остается в силе. Ибо, невзирая на постоянство небес, мореплаватели всегда теряли свой путь в океане – быть может, из-за того, что приборы, с помощью которых они ориентировались, становились непригодны. Точно так же и рецепторы, которые помогают клетке воспринимать морфогены и определять их концентрацию, начинают ошибаться, и тогда любое количество врожденных нарушений может быть вызвано поражающими их мутациями. Но, наверное, самый глубинный подтекст этого сопоставления связан с тем, что мореплаватели проводят сложные вычисления, чтобы установить, где они находятся. Клетки тоже калькулируют – причем делают это с большой точностью, поглощая информацию из окружающей среды, суммируя ее и получая искомый результат. Этот калькулятор – его можно назвать калькулятором судьбы – состоит из большого числа белков, объединяющих свои усилия внутри каждой клетки, чтобы прийти к верному решению. Конечно, калькулятор не безупречен: у клеток, как и у мореходов, в итоге иногда получаются неверные цифры. Каковы последствия таких сделанных клетками ошибок, прекрасно иллюстрирует один из наиболее любопытных образцов эротического искусства, обнаруженный при раскопках Геркуланума. Это мраморная статуэтка, размером не больше коробки из-под обуви, которая изображает козлоногого бога Пана, римляне называли его Фавном, насилующего козу. Соединив в искусной композиции равные по величине фигурки животного и человекоподобного божества, неизвестный художник наделил Пана обросшими шерстью ногами, раздвоенными копытами, толстыми губами, уплощенным лицом с написанным на нем выражением полной поглощенности актом насилия. Он также снабдил бога необычной анатомической характеристикой. На шее у Пана прямо над ключицами болтаются две небольших свисающих дольки, или мочки, которые не превысили бы в длину нескольких сантиметров, если бы Пан был изображен в "натуральную" величину. Дополнительные мочки на шее козы и сатира. "Пан, насилующий козу". Римская копия древнегреческого оригинала, II-III в. до н.э. (Вилла деи Папири в Геркулануме, Национальный археологический музей в Неаполе). Такие хорошо заметные образования появляются в изображениях Пана только во II или III веках до н.э., или, как на этой статуе (ныне находящейся в Секретном кабинете Археологического музея Неаполя), в более поздних римских копиях с греческого оригинала. Бесчисленные козлоногие боги, скачущие по черно- или краснофигурным вазам классического периода, преследуя пастухов и хватая нимф, не обладали этой особенностью, равно как и аллегории Пана эпохи Ренессанса или барокко, как, например, на картине Сандро Боттичелли "Марс и Венера" или Аннибале Караччи "Любовь побеждает все". Мочки на шее были бы также абсолютно неподходящей деталью для прекрасных, но скучных Панов прерафаэлитов. Происхождение шейных мочек у Пана легко объяснить: они перекликаются с парой идентичных образований, болтающихся на шее у его жертвы. Шейные мочки часто присутствуют у домашних коз: немецкие пастухи называют их Glocken – бубенчики, или сережки. Скульптор оригинальной композиции "Пан, насилующий козу" наверняка был внимательным наблюдателем природы. Наделив Пана мочками, он придал ему еще одну деталь, подчеркивающую его козлиную природу. Однако мочки на шее встречаются не только у коз, но также, хотя и достаточно редко, у людей. В 1858 году британский врач по фамилии Биркетт опубликовал короткое сообщение о семилетней девочке, которую привели к нему на прием, с парочкой торчащих по обе стороны шеи образований. Они были у нее с момента рождения. Хотя Биркетт не был уверен в их природе, он все же удалил их и, изучив под микроскопом, убедился, что это ушные раковины: у девочки была дополнительная пара наружных ушей.[73] Дополнительные мочки у восьмилетней девочки, Англия, 1858 г. Из книги Уильяма Бейтсона "Материалы для изучения изменчивости", 1894 (Империал-колледж, Лондон). Добавочные уши – это пример явления, называемого гомеозисом, при котором одна часть развивающегося зародыша аномально трансформируется в другую. Вышеописанная трансформация, которая приводит к появлению ушей на шее, имеет место примерно в пять месяцев после зачатия, когда на каждой стороне головы зародыша образуется пять хрящевых дуг, помещающихся примерно там же, где находились бы жабры, будь эмбрион рыбой. Действительно, если бы эмбрион становился рыбой, они превратились бы в жаберные дуги. У людей из них формируются разнообразные части головы, в том числе челюсти, мельчайшие косточки внутреннего уха и набор хрящей горла. Видимые, выступающие части нашего уха развиваются из расщелины между первой и второй парой дуг. Остальные щели при этом обычно зарастают, делая наши шеи гладкими, но иногда у людей и, как правило, у коз одна из ниже расположенных щелей остается открытой и формирует нечто, напоминающее ухо. Сходство это, однако, лишь поверхностное: "уши" лишены внутренней структуры, которая позволяла бы им слышать. Гомеозис был впервые открыт как особое явление британским биологом Уильямом Бейтсоном, который в книге 1894 года "Материалы для изучения изменчивости" предложил сам термин и привел около десятка собранных им примеров подобных трансформаций.[74] "Материалы..." чем-то напоминали средневековый бестиарий – или, как говорил сам Бейтсон, "воображаемый музей", в котором дети с добавочными ушами и телки с дополнительным числом сосков соперничали за место под солнцем с пятикрылыми бабочками, восьминогими жуками и омарами, у которых вместо глаз были антенны. В общем, странная получилась книга. И все же "Материалы..." и в наши дни не утратили своего значения и продолжают цитироваться молекулярными биологами, что можно считать редкостью для зоологических компендиумов XIX века. Это происходит потому, что выявленные Бейтсоном трансформации указывают путь к одному из самых замечательных механизмов эмбриона – генетической программе, которая позволяет клеткам, а тем самым тканям и органам, становиться отличными друг от друга. Гомеозис указывает путь к калькулятору судьбы. Калькулятор судьбы был впервые открыт у плодовых мушек. Мухи, как и дождевые черви, разделены на повторяющиеся звенья, или сегменты. Эти сегменты особенно заметны у личинок, хотя метаморфоз иногда скрывает их границы. Многие сегменты у взрослых мух так или иначе специализированы. Головные сегменты несут на себе губные щупики (с помощью которых муха питается) и антенны (которые нужны для обоняния); грудные (торакальные) сегменты снабжены крыльями, ногами и небольшими, предназначенными для равновесия органами, которые называются жужжальца; брюшные (абдоминальные) сегменты не имеют никаких придатков. Вопрос о том, какие именно органы будут у данного сегмента, решается во время эмбрионального развития, задолго до того, как эти органы можно будет увидеть. Или, выражаясь более абстрактно, у эмбриона каждый сегмент получает свою идентичность. За последние восемьдесят с лишним лет генетики, специализирующиеся на дрозофилах, искали и обнаружили десятки мутаций, разрушающих идентичность сегментов. Некоторые из этих мутаций заставляют мух отращивать ноги вместо антенн у себя на головах; другие вынуждают жужжальца превращаться в крылья, создавая тем самым четырехкрылое двукрылое, что противоречит главной характеристике насекомого. Но есть и такие мутации, которые заставляют крылья становиться жужжальцами – и обрекают муху на безысходно земное существование. Эти мутации вносят разрушения в целый ряд генов, которые, в знак признания заслуг Уильяма Бейтсона, получили название гомеозисных.[75] Их всего восемь, и они имеют такие, например, названия, как: Ultrabithorax, Antennapedia, или, попроще, – deformed (деформированный). Эти названия напоминают о странных мухах, которые появляются на свет, пораженные теми или иными мутациями. Гены – переменные в уравнении, решение которого делает каждый сегмент отличным от другого. Калькулятор судьбы сегмента – необычайно красивая вещь. Он имеет экономную булевскую[76] логику компьютерной программы. Каждый белок, кодируемый гомеозисным геном, присутствует в отдельных сегментах. Некоторые имеются в голове, другие – в грудной клетке, третьи – в брюшных сегментах. Идентичность сегмента – и те придатки, которые на нем вырастут, – зависит от точной комбинации гомеозисных белков, присутствующих в его клетках. Так, например, уравнение для третьего грудного сегмента, на котором в норме располагаются жужжальца, будет иметь примерно следующий вид: Если Ultrabithorax присутствует, А все остальные постериорно расположенные гомеозисные белки отсутствуют, Тогда третий грудной сегмент имеет: ЖУЖЖАЛЬЦА. Это попросту означает, что Ultrabithorax необходим для того, чтобы на третьем грудном сегменте выросли жужжальца, то есть чтобы он и стал именно третьим грудным сегментом. В случае мутации гена кодируемый им белок, даже если и будет присутствовать, не сможет выполнить своей функции. Уникальная идентичность сегмента потеряна: он становится вторым торакальным сегментом и будет снабжен крыльями. Когда в 1980-х годах были проведены эксперименты по клонированию и секвенированию гомеозисных генов, оказалось, что они кодируют молекулярные переключатели – белки, которые включают и выключают гены. Молекулярные переключатели контролируют продукцию матричной (информационной) РНК. Большая часть генов содержит информацию для создания белков. Однако эта информация должна быть каким-то образом передана. Этой цели служит матричная РНК, молекула, похожая на ДНК, с той разницей, что это не двойная спираль, а просто длинная цепь нуклеотидов. Матричная РНК – это копия ДНК, продуцируемая с помощью механизма, который передвигается по генным последовательностям, как локомотив по рельсам. Молекулярные переключатели, или, как их правильно называют, факторы транскрипции, контролируют этот процесс. Связываясь с "регуляторами" – небольшими последовательностями ДНК, окружающими каждый ген, факторы транскрипции модифицируют работу молекулярного механизма, который отвечает за создание матричной РНК, и пытаются влиять на этот процесс. Некоторые факторы транскрипции стремятся ускорить работу механизма, другие, напротив, приостановить ее. Связанные с регуляторами, факторы транскрипции противостоят друг другу и соревнуются за контроль над двойной спиралью. Подобно любым конфронтациям, исход зависит от равновесия сил: разнообразия противостоящих друг другу групп или просто их численного соотношения. Последовательности восьми гомеозисных генов плодовой мушки совершенно различны. И все же в каждой из них есть область – последовательность всего лишь из 180 пар оснований, которая кодирует, с небольшими вариантами, следующую цепочку аминокислот: RRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEI. Это гомеобокс. В изобилующей субмикроскопическими выступами и складками трехмерной структуре гомеозисного белка именно последовательность гомеобокса, гнездящегося в бороздках двойной спирали ДНК, приводит гомеозисные белки к цели – сотням, а может быть, и тысячам генов, находящихся под их контролем. Мельчайшие различия в гомеобоксе каждого белка позволяют ему контролировать определенные наборы генов. Открытый в 1984 году гомеобокс, столь же характерный, как губа Габсбургов, означал, что гомеозисные гены все связаны друг с другом и представляют собой особое семейство. Они найдены в червях, улитках, морских звездах, рыбах и мышах. Обнаружены они и у нас. Возможно, они были у самых первых животных, которые выползли из докембрийского болота миллиарды лет назад. Но еще более интригующим оказывается следующий вопрос: если гомеобоксные гены обеспечивают работу цепей в калькуляторе частей у плодовой мушки, могут ли они выполнять ту же функцию у всех живых существ, включая человека? Молекулярные биологи – не те люди, которые склонны гиперболизировать, но когда они нашли гомеобокс, то вспомнили о Священном Граале и Розеттском камне. И в этом они были абсолютно правы. Почему – показывает еще один из экспонатов Фролика, на этот раз скелет. С первого взгляда он кажется довольно скучным образцом человеческого скелета. Он не искривлен рахитом и не согнут ахондроплазией; в нем нет ничего необычного, разве только то, что его череп, конечности и таз давным-давно где-то потерялись. Остался лишь позвоночник с характерными изгибами и коричневатыми ребрами, крепящийся на заржавленной металлической опоре, – в целом довольно жалкое зрелище. Его даже не выставляют в экспозиционных галереях, он прописан в подвале, где соседствует на полке с другими скелетами, собранными в течение столетия, но сейчас представляющими собой комплекты костей, которые выдаются по требованию специалистов. И тем не менее именно этот скелет пользуется негромкой славой. Каждую весну его выносят на свет божий, когда демонстрируют новой группе студентов-медиков государственного университета, которым предстоит определить его аномалию. Обнаружить ее на удивление трудно, хотя, после подсказки, кажется, что это проще простого: у скелета лишняя пара ребер. Дополнительные ребра всегда вызывал и тревожные чувства. В своей книге "Лженаука суеверий" сэр Томас Браун повествует о том, как однажды анатом Ренальдо Колумб вскрывал в Пизе женщину, у которой с одной стороны оказалось тринадцать ребер: "...тотчас образовался кружок, где стали его обвинять и даже клятвенно утверждать, что это и есть то самое ребро, каковым женщина имеет перевес". "Будь это правдой, – продолжает Браун, – тогда, не прибегая к оракулам, умолкли бы споры, с какой стороны было взято ребро для Евы". Влияние соответствующего отрывка из Книги Бытия (II: 21-22) на популярные представления об анатомии было довольно губительным. Недавно я спросил группу из тридцати студентов-биологов (среди которых были лучшие и самые одаренные учащиеся Британии), сколько ребер у мужчин и женщин – одинаковое количество или нет. Человек пять или шесть на этот вопрос ответили "нет". "Но, – как говорит сэр Томас с присущей ему живостью ума, – это мнение не соответствует здравому смыслу или наблюдениям. Так как если мы обследуем скелеты обоих полов и состав костей в них, то без труда обнаружим, что у мужчин и женщин имеется четыре плюс двадцать ребер, то есть по двенадцать с каждой стороны".[77] Все это так, и тем не менее дополнительные ребра на удивление часто встречаются: их имеет примерно один из каждых десяти взрослых людей (причем у женщин они встречаются не чаще и не реже, чем у мужчин).[78] У большинства из нас имеется тридцать три позвонка. Начиная с головы насчитывается семь шейных позвонков, затем двенадцать, к которым прикрепляются ребра, потом пять в поясничной области, еще девять сросшихся вместе для образования крестца и копчика, или хвостового отдела. У большинства людей с дополнительными ребрами этот порядок нарушен. Позвонок, в норме не имеющий ребер, трансформируется в тот, к которому они прикрепляются. Иногда это означает утрату одного шейного позвонка, иногда – одного поясничного. Так или иначе, гомеозисные трансформации очень напоминают трансформации сегментов, которые генетики изучают у плодовых мушек. В таком случае неудивительно, что идентичность каждого позвонка контролируется гомеозисными генами, подобно тому как это происходит у дрозофилы при определении порядка сегментов. Конечно, в нашем случае дела обстоят намного сложнее. У плодовых мушек всего лишь восемь гомеозисных генов, а у млекопитающих их тридцать девять – слишком много для иносказательных латинизированных наименований, от которых пришлось отказаться. Никаких там Ultrabithorax или proboscipedia, с нас хватит префикса Hox с последующими незапоминающимися буквами и цифрами: Hoxa3, Hoxd13 и т. д. У млекопитающих, как и у плодовых мушек, гомеозисные гены начинают свою работу на очень ранних стадиях жизни зародыша. Позвонки образуются из блоков мезодермы, называемых сомитами, которые формируются по обе стороны нервного тяжа, как ряды маленьких кирпичиков. Каждый гомеозисный белок присутствует лишь в некоторых из сомитов. Все тридцать девять имеются в хвостовых сомитах, но затем они исчезают, по одному или попарно, так что в конце концов у ближних к голове сомитов их остается совсем немного. Калькулятор для расчета позвонков нельзя назвать экономным. Для 7-го шейного позвонка уравнение выглядит примерно так: если Hoxa4 присутствует, и Hoxa5 присутствует, и Hoxb5 присутствует, и Hoxa6 присутствует, и Hoxb6 присутствует, а все остальные постериорно расположенные Hox-гены отсутствуют, тогда 7-й шейный позвонок формируется: БЕЗ РЕБЕР. Если мутация разрушит какой-либо из генов, кодирующих эти пять белков, 7-й позвонок трансформируется в своего соседа – 8-й позвонок и приобретет парочку ребер.[79] Сомиты человеческого эмбриона. Из книги Франца Кайбеля "Нормальные таблицы развития человека", 1908. Фритсон Галис (Лейденский университет). Сделать позвонки отличными друг от друга – всего лишь один из примеров проблемы, которую зародышу приходится решать постоянно и которая связана с дифференциацией частей по оси голова-хвост. Эмбрион должен решать эту задачу в отношении нервной трубки, поначалу единообразной, но впоследствии с образующимся на одном конце головным мозгом. Он должен решать ее для костей головы, так чтобы верхняя челюсть формировалась рядом с нижней и к каждой из них прикреплялись бы соответствующие нервы и мышцы. Он должен решать эту проблему и для кишечной трубки, из которой сформируются желудок, печень, поджелудочная железа и кишечник, а также брюшной кровяной сосуд, впоследствии образующий четыре камеры сердца. С такими вот задачами приходится справляться генному калькулятору. Как он работает у млекопитающих, известно из экспериментов на мышах с делециями одного или более Hox-генов. Эти мыши часто имеют глубокие нарушения. У одних передние конечности странно близко придвинуты к голове, у других отсутствуют части ромбовидного мозга или черепно-мозговые нервы. У некоторых такие грыжи, что кишечник вытесняется в грудную полость или у них не зарастает нервная трубка. У кого-то отсутствует вилочковая, щитовидная и паращитовидные железы, а сердце и лицевая часть головы несут множество аномалий. Некоторые ходят на пальчиках, а не на подошвах стоп, при этом их задние конечности подвержены непроизвольным конвульсиям. Большая часть мышей с делецией хотя бы одного Hox-гена умирает в молодом возрасте.[80] Полагают, что генный калькулятор подобным же образом работает и у людей. Доказательством тому, хотя и косвенным, служит единственное исследование 1997 года, в котором группа лондонских ученых изучала шесть зародышей, абортированных с помощью пилюли PY-486, "наутро после пилюли". Зародышам было по четыре недели, в длину они достигали 5 миллиметров и все были результатом нежелательной беременности. Ученые пометили их молекулярными датчиками, чтобы обнаружить время и место экспрессии гомеозисных генов. На авторадиограммах окрашенных срезов эмбрионов активность Hox-генов выявлялась в виде зернистых штрихов и белых пятен на темном фоне зарождающихся структур ромбовидного мозга и жаберных дуг. Характер активности Hox-генов был в точности таким, каким его следовало ожидать исходя из опытов на мышах. Иметь такие результаты важно и приятно. Но это исследование никогда не было повторено. Изучение человеческих эмбрионов – большая редкость. В Соединенном Королевстве подобные изыскания можно проводить, только если преодолены все устрашающие организационные преграды. В Соединенных Штатах их выполнение и вовсе запрещено, по крайней мере для учреждений, финансируемых из федерального бюджета. Авторадиограммы, являющиеся исходным материалом для таких исследований, обладают одним свойством, вызывающим беспокойство. Возможно, это связано с тем, что качество, которое обнаруживается у эмбрионов после смерти, – генная активность, на самом деле является принадлежностью живых существ.[81] Три тысячи переключений Говоря о "калькуляторе судьбы", я подчеркивал роль тридцати девяти Hox-генов. Но человеческий геном кодирует три тысячи других факторов транскрипции. Подобно сигнальным молекулам, на которые они реагируют, транскрипционные факторы образуют семьи, одну из которых и представляют гомеобоксные гены. Транскрипционные факторы являются компонентами сетей, если хотите – переключателями, которые мобилизуются, когда клетки калькулируют свою будущую судьбу. Этот вычислительный процесс носит поступательный характер, так что первые зародышевые клетки, еще не обученные, но с уймой открывающихся перед ними возможностей, испытывают, пожалуй, наиболее жесткий прессинг относительно того, кем именно они станут. Некоторые из вычислительных уравнений, например, те, которые работают применительно к позвонкам, в общем, понятны; другие мы только сейчас начинаем узнавать. В 1904 году один тирольский трактирщик зарезал курицу, которая вместе с другими бродила по двору, и обнаружил у нее ни много ни мало как семь сердец. Курьез? Возможно. Однако в 2001 году было установлено, что при удалении у мышей гена под названием β-катенин у эмбриона возникает цепочка дополнительных сердец, каждое из которых бьется и перекачивает кровь. Добавочные сердца образованы из ткани, которая обычно предназначена для кишечника.Так выявляется небольшой кусочек другого уравнения, при решении которого необученные зародышевые клетки становятся эндодермой или мезодермой.[82] Другие нарушения свидетельствуют о наличии уравнений, о которых нам вообще ничего не известно. Например, в глазном веке существует ряд скрытых железок (мейбомиевы железы), которые иногда, хотя и редко, трансформируются в волосяные фолликулы. Дети, у которых утрачены мейбомиевы железы, имеют вместо них два или даже три ряда ресниц на каждом веке. Эта черта передается по наследству, но ген, отвечающий за превращение эпидермиса века в железу, а не в волосяной фолликул, пока что не найден (и кажется сомнительным, чтобы кто-то его искал).[83] И наконец, существует дезорганизация. Мутантные мыши с донельзя кошмарными и невероятно странными характеристиками стали объектом всего лишь трех научных работ. Три особенности делают дезорганизацию странной. Первая – это масштаб распространения дефектов у мышей, которые ею страдают. Неоправданной жестокостью было бы описание всех деталей внешности этих мышей-мутантов: достаточно сказать, что уродств одного помета хватило бы для заполнения просторного тератологического музея. Тем не менее мутация вовсе не обязательно летальна. Второе странное свойство дезорганизации состоит в том, что двух мышей-мутантов с одинаковым набором дефектов не существует. У некоторых выявляются совершенно ничтожные поражения, и они могут жить и размножаться, другие рождаются изуродованными, но живыми, третьи умирают во чреве. Подобные вариации встречаются даже у одной мыши: левая почка (либо легкое, либо нога) может быть полностью разрушена, а правый аналогичный орган остается по существу нетронутым. И последнее: у мышей-мутантов обнаруживается странная склонность генерировать добавочные части тела – не только конечности (которые могут появляться на теле практически в любом месте), но также дополнительные внутренние органы, такие как печень, селезенка и кишечник. В мышцах и коже мышей имеются, кроме того, странные опухолеобразные структуры, напоминающие остатки лишних органов, которые почему-то не смогли до конца развиться. Существует ли у человека ген дезорганизации? Неизвестно ни одной человеческой семьи со свойствами, похожими на проявления дезорганизации. Однако некоторые медицинские генетики говорят о детях с совершенно непонятным набором врожденных аномалий как возможных носителях передающейся по женской линии мутации. Один такой ребенок – мальчик, родившийся в 1989 году, имел девять пальцев на одной ноге и опухолеобразные разрастания тканей, разбросанные по всему телу. У него имелся также вполне сформированный палец с ногтем, который рос с правой стороны грудной клетки. Ген дезорганизации пока что не найден, но можно быть уверенным, что это вскоре случится. А до того слово имеют мыши. Они рассказывают о некоем важнейшем, глобальном и абсолютно неизвестном компоненте калькулятора судьбы эмбриона, который полностью вышел из строя.[84] Mutatis mutandis[85] Власть гомеозисных генов над количеством и типом частей тела позволила некоторым ученым предположить, что они должны были играть важную роль в эволюции; что они каким-то образом определяли потрясающее разнообразие форм у животных – от червей до китов. В этом наверняка что-то есть. Люди с дополнительными ребрами, в особенности те, у кого эти ребра расположены там, где должна быть шея, несколько напоминают, к примеру, змей. У змей шеи вообще нет: у них есть позвонки, несущие ребра вдоль всего тела, до самой головы. Это происходит потому, что характер активности Hox-генов в сомитах эмбрионов змей совершенно отличен от такового у рептилий, которые обладают шеей, у птиц и млекопитающих. Кстати, это различие также объясняет тот факт, почему у змей нет рук. Положение рук, или шире – верхних конечностей, диктуется тем же самым генным калькулятором, который принимает решение о судьбе позвонков от шеи до грудной клетки. Нет шеи, нет и рук – просто, как апельсин.[86] Однако притягательность гомеозисных генов состоит не столько в различиях между видами, сколько в их сходстве. Универсальность этих генов попросту поразительна. Мухи пользуются ими, чтобы навести порядок в своих сегментах; мы используем их, чтобы отсортировать позвонки, но в обоих случаях общим является то, что и там и здесь происходит формирование органов вдоль оси тела голова-хвост. Кроме того, сходство между гомеозисными генами позвоночных и насекомых лежит гораздо глубже примеров их общего использования: оно касается непосредственно генома. Гомозисные гены образуют кластеры – группы генов, расположенные друг подле друга на одной хромосоме. Первые несколько генов в гомеозисном кластере плодовой мушки определяют идентичность ее головных сегментов, следующие – выполняют ту же функцию для торакальных, и последние – для абдоминальных сегментов. Существует, по-видимому, довольно-таки немудреное соответствие между порядком расположения генов в хромосоме и структурной последовательностью самой мухи. Так же, с соответствующими изменениями (mutatis mutandis), обстоит дело и у человека. У нас имеется четыре кластера гомеозисных генов на четырех хромосомах, а не один, как у мухи, но внутри каждого кластера сохраняется тот же порядок расположения генов вдоль хромосомы, что и у мухи. В точности, как у мухи, первые гены каждого кластера необходимы для формирования нашей головы, последние – хвостового отдела, а остальные – для образования расположенных между этими двумя полюсами частей. Почему гомеозисные гены должны действовать таким образом и почему они по-прежнему сохраняют эту свою способность, не вполне ясно. Тем не менее они указывают на систему построения организма, которая сформировалась, возможно, сотни миллионов лет назад у какого-то червеобразного предка и до сих пор сохранилась. Действительно, гомеозисные гены были всего лишь первым указанием на то, что многие молекулярные механизмы, задействованные в формировании нашего тела, отличаются большой древностью. На протяжении последних десяти лет стало ясно, что мы во многих отношениях – всего лишь черви, но разросшиеся. Ген под названием ems нужен плодовой мушке для того, чтобы у нее образовался крошечный мозг. Эволюционная пропасть – и по времени, и по структурной сложности, – отделяющая мушиный мозг от того сооружения в сотни миллионов нейронов, которое сидит у нас на плечах, столь огромна, что трудно представить себе возможность использования в обоих случаях тех же самых механизмов. И тем не менее мутации в человеческом аналоге ems вызывают наследственное расстройство, выражающееся в появлении избыточных борозд на мозге (а следовательно, в умственной отсталости и нарушении моторики).[87] Еще один мушиный ген, так называемый "eyeless" ("безглазый"), необходим для формирования фасеточных глаз дрозофилы. Мухи, лишенные гена eyeless, в общем, да, безглазы. То же, по сути, происходит и с людьми в случае наличия у них наследственной мутации в родственном гене. Они рождаются без радужной оболочки глаза.[88] В соответствии с циклическим характером интеллектуального развития все это уже было высказано ранее, хотя и не в столь прямой форме. Более ста пятидесяти лет назад Этьен Жоффруа Сент-Илер – этот эксцентрический гений и Линней мира уродств, открыватель универсального закона взаимного сродства – пытался создать новую отрасль науки, анатомическую философию, которая бы продемонстрировала, что животный мир, с виду столь обширный и разнообразный, по существу един. Его изначальные цели были достаточно скромными. Жоффруа стремился показать, что структуры, возникающие у млекопитающих, являются по существу теми же, лишь модифицированными по сравнению с другими позвоночными, как то: рыбы, рептилии и амфибии. Другими словами, он пытался идентифицировать то, что мы сейчас называем гомологами, доказывая, к примеру, что оперкулярные кости рыб (прикрывающие жабры) – это, по сути, то же, что и мельчайшие косточки среднего уха у млекопитающих (молоточек, стремечко и наковальня). Но такому склонному к обобщению мыслителю – истинному "синтезатору", каким был Жоффруа, оперкулярных костей показалось мало. Он продолжал искать гомологии между на удивление несхожими структурами у самых что ни на есть различных существ. Сопоставляя наружный скелет насекомого и позвонки рыб, он высказал суждение, что это одно и то же. Никто не спорит, насекомые имеют наружный скелет (все их внутренности окружены твердыми частями), а рыбы – внутренний (у них кости окружены мягкими частями). На этом основании другие анатомы считали возможным разделять эти существа. Жоффруа, с откровенной убежденностью визионера, объяснял, что "каждое животное существует внутри или вне своего позвоночного столба". Не удовлетворившись этим, он пошел дальше, дабы показать, насколько анатомия омара сходна с таковой позвоночного – стоит только перевернуть первого на спину. Если у омаров их основной нервный тяж расположен на вентральной (брюшной) стороне, а основные кровеносные сосуды на дорзальной (спинной), то у позвоночных все происходит ровно наоборот. А ведь был еще и любопытный пример с головоногими: если взять утку и свернуть ее пополам, так чтобы хвост коснулся головы (надеюсь, что этот эксперимент проводился только на бумаге), разве ее анатомическое строение не напомнит таковое каракатицы? Нет, не напомнит. Рассуждения Жоффруа вызвали приступ ярости у Кювье, его могущественного соперника по Музею, в результате чего в 1829 году были организованы публичные дебаты в присутствии членов Французской академии наук. Жоффруа потерпел поражение: утка не похожа на каракатицу, как бы вы ее ни свернули; даже его рассуждения о сходстве между оперкулярными костями рыб и косточками среднего уха не выдерживали серьезной критики. И все же если конкретные приведенные им примеры гомологий иногда выглядели абсурдными даже для того времени, то предложенный им метод таковым не являлся. Различные организмы действительно наделены сходными, хотя и модифицированными, структурами. Представление о гомологиях является общим местом в сегодняшней биологии (мы говорим о гомологичных генах с той же легкостью, как о гомологах конечностей), и потому легко вычитать в рассуждениях Жоффруа тот эволюционный смысл, который сам он в них не вкладывал. Гомологии, которые он наблюдал, или думал, что наблюдает, были, по его мнению, сотворены Создателем. Это был век, если так допустимо выразиться, Трансцендентной Анатомии.[89] Сегодня едва ли возможно изучать развитие какого бы то ни было существа, не сравнивая его с другими. Это происходит потому, что животные, сколь бы разными они ни выглядели, по-видимому, наделены общими комплексами молекулярных механизмов, которые являются наследием общей эволюционной истории. Они используются снова и снова, часто с различными целями, но остаются узнаваемо схожими, где бы мы их ни встретили. Действительно, именно об этом говорят результаты проектов по секвенированию геномов. У людей имеется 30 тысяч генов, у мух – 13 тысяч. Разница в количестве генов значительно меньше, чем можно было бы предположить исходя из огромных различий, по крайней мере кажущихся, и в размерах, и в усложненности строения у представителей двух видов. Другое существо, к которому с нежностью относятся специалисты по биологии развития, – круглый червь Caenorhabditis elegans – имеет 19 тысяч генов, хотя взрослые особи достигают всего лишь 1,2 миллиметра в длину, а в их организме насчитывается только 959 клеток. Некоторые из специфических идей Жоффруа сегодня вновь обретают жизнь. Среди них – его представление, на первый взгляд абсолютно абсурдное, что позвоночное животное на четырех ногах – это все равно что омар, перевернутый на спину. В предыдущей главе я рассказывал о сигнальных молекулах, которые соревнуются друг с другом в формировании передних и задних частей эмбрионов позвоночных. Те же самые молекулы, или, чтобы быть точным, их родственники, или гомологи, дифференцируют спину от живота у плодовых мушек, но в противоположном направлении. Если у зародыша позвоночных сигналы BMP-4 приказывают клетке формировать живот, то у дрозофил родственная молекула дает клетке инструкции по образованию спины. И там, где у эмбрионов позвоночных хордин стимулирует клетку к образованию спины, у мушек родственная молекула отдает приказ образовывать живот. Где-то в эволюционном хиатусе, разделяющем мух и мышей, по-видимому, произошла инверсия в самих молекулах, формирующих пространственное расположение частей эмбриона. Эта инверсия чем-то до боли напоминает переворот с одной стороны на другую, о котором говорил Жоффруа. Абсурд? Может быть, и нет. Это одна из тех необъяснимых аналогий, которых следует ожидать в век Трансцендентной Генетики. Глава IV Клешнепалые [о руках и ногах] Фокомелия. Скелет Марка Казотта по прозвищу Маленький Пепин (1757-1801). Из книги Виллема Фролика "Таблицы для иллюстрации эмбриогенеза человека и животных в норме и в аномалиях", 1844-1849 (Библиотека Уэллком, Лондон). Из всех доктрин, когда-либо созданных для объяснения человеческих уродств, ни одна не вызывает большего неприятия, чем та, которая считает их следствием некоего морального падения. Ее можно было бы назвать "псевдокаиновой печатью".[90] Согласно иудейско-христианской традиции, за убийство брата Бог отметил Каина и все его потомство. В армянском апокрифическом тексте Каин наделен рогами; в одной истории среднеирландского периода у него на лбу, щеках, руках и ногах появляются шишки; автор "Беовульфа" делает его предком чудовищного Гренделя. Ничего этого мы на самом деле не обнаружим в Книге Бытия, которая на фоне вышеперечисленного может даже показаться скучной. В ней Каин наказан изгнанием, и сделанное Богом "знамение" призвано защитить его, причем что это за знамение, остается непонятным. Но в целом связь между моральным и физическим уродством никогда в действительности и не требовала отсылок на авторитет Библии. Для появления уродства не требовались даже безобразные родители. В 1999 году тренер английской национальной футбольной сборной[91] высказал одному интервьюеру такое мнение: "Нам с вами были физически даны две руки, две ноги и приличный мозг. Некоторые люди такими не уродились, и на то есть причина. Карма переходит из другой жизни. Что посеешь, то и пожнешь". Он почерпнул эти идеи у буддистского целителя. В Великобритании ложные представления о печати Каина процветали совсем еще недавно (о футбольных тренерах мы не говорим) – в XVII столетии. В 1685 году в отдаленной и унылой деревне Уигтаун, области Галлоуэй, две вероотступницы, Маргарет Маклафлин и Маргарет Уилсон, были преданы суду и приговорены к смерти за преступления против государства. Печальная известность этой истории связана с крайней жестокостью того способа, которым их казнили. Обеих женщин привязали к столбам в устье реки Бледнох и оставили там в ожидании прилива. Различные рассказы, ни один из которых не относится непосредственно к тому времени, когда произошли события, повествуют о том, как они умирали. Маклафлин, пожилая вдова, ушла из жизни первой. Уилсон, которой было всего восемнадцать лет, продержалась дольше. Помощник шерифа, думая, что смертные муки вдовы должны подействовать на психику молодой девушки, пытался заставить ее отказаться от своей веры: "Скажи: Боже, спаси короля Чарли, и я сниму веревку с твоей шеи". Он недооценил волю девушки. По некоторым рассказам, ее ответом была долгая и набожная речь; по другим – она запела 25-й псалом и прочла 8-ю главу Послания апостола Павла к Римлянам. Но все отчеты сходятся в том, что ее последние слова были открытым проявлением неповиновения:"Боже, спаси короля Чарли, если сможешь". В ответе офицера прозвучала явная любовь к местному диалекту: "Тогда ступай на дно кормить клешнепалых". Потом он взял свою алебарду и утопил девушку. Слова палача довольно любопытны. На старошотландском диалекте слово "клешнепалые" ("cleppies") означало "крабы". Таким образом, он отправлял ее на дно кормить крабов. Еще одна версия той же истории гласит, что офицера якобы спросили (кто-то из тех, кто, очевидно, пропустил занимательное зрелище), как вели себя женщины, когда над ними смыкались воды. "О-о-о, – ответил он, наслаждаясь собственным остроумием, – они сзывали подонков вроде клешнепалых и молились". Так или иначе, но с этого места рассказ из разряда историй о казни мучеников переходит в миф. Ибо, по-видимому, вскоре после того, как офицер, фамилия которого была Белл, совершил свое гнусное дело, у его жены родился ребенок, отмеченный неискоренимой печатью вины своего отца: вместо пальцев у него на руках были клешни, как у крабов. "Парнишка клешнепалый!" – закричала повитуха. Печать ниспосланной небом кары за преступление Белла сохранится и у его потомков, многие из которых унаследуют это уродство и будут известны как Клешнепалые Беллы. Место, где, как считают, погибли женщины, отмечено каменным монументом в виде столба. Сегодня он стоит на поросшем камышом болоте, далеко от края воды, так как за прошедшие три столетия Бледнох изменил свое течение. Еще один, намного более внушительный памятник двум мученицам стоит на холме, который возвышается над городом, а их могилы, с тщательно сохраняемыми надгробьями, можно найти на местном кладбище. Как и всегда, шотландцы не без удовольствия бередят свои исторические раны.[92] Синдром расщепленной кисти – расщепленной стопы, или эктродактилия, или синдром клешни омара. Девочка с рентгенограммой материнской ступни. Из книги Карла Пирсона "О наследовании уродства, известного под названием расщепленной ступни, или клешни омара" (Biometrica, 9: ЗЗ0-ЗЗ1. Из собрания автора). Существуют и другие современные отголоски этого события. Совсем уже недавно, в XIX веке, у членов семьи с фамилиями Белл и Агнью руки от рождения были изуродованы и напоминали крабьи клешни. Они жили на юго-востоке Шотландии и, как говорят, были потомками тех самых Клешнепалых Беллов. Больше мы ничего о них не знаем. Может быть, они и до сих пор живут там. Зато нам известно, что в 1908 году представители большой семьи (фамилия их не называлась), живущей в Лондоне, но имеющей шотландские корни, стали объектом одного из первых генетических исследований телесных человеческих нарушений. Их аномалия, известная в то время как синдром клешней омара, – это, конечно, тот же самый дефект, которым страдали Клешнепалые Беллы. В наши дни специалисты по клинической генетике избегают говорить о клешнях омара, а называют аномалию синдромом расщепленной кисти – расщепленной стопы, или эктродактилией. Последний, ласкающий слух термин означает, если точно перевести непонятные греческие слова, "уродливые пальцы". Эта вторая шотландская семья также могла быть связана родственными узами с Клешнепалыми Беллами, но вполне возможно, что они в родстве не состояли и что деформация возникла независимо в двух семьях. Итак, на одном конце нашего рассказа – исторический судебный процесс и смерть двух Маргарет – Уилсон и Маклафлин, на другом – Клешнепалые Беллы и клиническая литература. Мифологический элемент лежит, конечно, в причинно-следственной связи между этими двумя полюсами. Ничто из совершенного офицером Беллом не могло заставить его потомков родиться всего лишь с двумя широко расставленными пальцами на руках. Если у Беллов и появились "клешни", то потому только, что кто-то из них был носителем доминантной мутации, поражающей рост зачатков конечностей на стадии внутриутробного развития. И крабы здесь были абсолютно ни при чем. Использование конечностей Фрагменты мифов, фольклора и традиционных представлений, доставшиеся нам в наследство от донаучной эры, подобны следам, которые оставляют на песке убегающие волны: лишенные силы и значения, они тем не менее воспроизводят некий порядок вещей. Как и первые – замутненные временем и запутанными причинно-следственными связями, они при всем том несут на себе отпечаток законов природы. Безусловно, важно, что в этих популярных историях, независимо от их происхождения, никакие другие части человеческого тела так не подвержены уродствам, как конечности. В греческой мифологии был только один олимпиец, наделенный телесным уродством, – хромоногий Гефест. Брошенный Герой (своей матерью), обманутый Афродитой (своей женой) и с презреньем отвергнутый Афиной (страстью к которой был одержим), он тем не менее научил людей тайнам работы с металлом и стал богом ремесленников и кузнецов. На черно-краснофигурной керамике он обыкновенно изображается с врожденной двусторонней деформацией стопы – talipes equinovarus, или двусторонней косолапостью.[93] Эдип, самый знаменитый из изуродованных смертных, носил соответствующее имя.[94] Новые легенды возникают даже в наши дни. В середине 1960-х годов чиновник родезийского министерства по делам аборигенов заявил, что знает племя людей с двупалыми ступнями, обитающее в труднодоступных районах долины реки Замбези. Его описания напоминали рассказы Плиния Старшего о сказочных расах людей из Эфиопии и Индии. По его словам, их называют по-разному: уадома, вадома, дома, ваньяи, талунда или совсем уж экзотически – "страусоногие люди". Это примитивная, изолированная группа охотников-собирателей, которые благодаря своим удивительным ногам могут бегать очень быстро, как газели. Достоверность рассказу придавала фотография одного вадома, демонстрирующего свою примечательную ногу. В 1969 году та же самая фотография появилась в газете "Сандерболт", издаваемой Национальной партией борцов за права штатов,[95] с комментарием, что коль скоро у некоторых африканцев "ноги как у животных", их нужно относить к отдельному виду ("Негры родственны обезьянам – а не белым людям"). Американские ученые, движимые чувством справедливого возмущения, разоблачили фотографию как подделку. И это была ошибка с их стороны, так как вскоре этим вопросом занялись генетики, которые обнаружили, что вадома действительно существуют и, хотя далеко не все члены племени "страусоногие", среди них есть одна семья, пораженная этим явно новым видом эктродактилии. Но уничтожить хороший миф практически невозможно. В середине 1980-х годов два южноафриканских журналиста заявляли, что обнаружили целое племя двупалых людей в отдаленных районах Замбези. Ныне существует несколько веб-сайтов, утверждающих, что вадома поклоняются огромному металлическому шару, спрятанному в джунглях, и являются в действительности инопланетянами.[96] Конечности обладают необыкновенной способностью к возникновению аномалий.[97] По сравнению с любой другой частью тела существует намного больше наименований врожденных нарушений, поражающих наши конечности. Происходит ли это потому, что конечности особенно чувствительны и склонны регистрировать всякое неблагоприятное воздействие, оказываемое на них генетикой или средой? Они действительно чувствительны и сложны, в этом нет сомнения, но более вероятная причина чрезвычайного обилия в них всевозможных несовершенств заключается в том, что они попросту не так уж важны, во всяком случае – с точки зрения самой жизни. Дети вырастают в утробе и рождаются с лишними пальцами, отсутствующей большой берцовой костью или вообще полностью отсутствующей конечностью, хотя и вполне здоровые во всех других отношениях. Они прекрасно выживают, и их дефекты становятся заметны. Одна из удивительных загадок конечностей состоит в том, как легко можно компенсировать их отсутствие – частичное или полное. Вот как ответил генетику патриарх одного семейства с эктродактилией: "Что вы, сэр, дети вовсе об этом не думают. Они никогда не пользовались пальцами на руках и ногах и потому не замечают их отсутствия". Да и почему они должны его замечать? Они держат ручку и карандаш в школе, когда пишут или рисуют, а могут пользоваться и ниткой с иголкой. Среди взрослых членов этой семьи были сапожник и шофер, а также трюкач, который подбирал с пола булавки, пользуясь двумя широко расставленными пальцами ноги. Диапазон нервных и физических возможностей конечностей с еще большей очевидностью демонстрируют люди, полностью лишенные рук. Среди всех безруких артистов наиболее притягательна своей отчаянной смелостью личность Германа Хунтана – безрукого скрипача. Он родился в 1848 году в небольшом немецком городке и едва не был задушен акушеркой. Строгие, но любящие родители растили его, воспитывая чувство уверенности в себе, хотя сейчас их методы могут показаться кому-то совершенно бессердечными. В первые же дни после его рождения отец приказал всем окружающим никогда не жалеть сына, ни в чем ему не помогать и не давать ему обувь или носки. В 1868 году молодой Герман играл скрипичные концерты перед восхищенной венской публикой, в то время как за дирижерским пультом стоял еще более юный Иоганн Штраус. Герман прожил долгую и насыщенную разнообразными событиями жизнь, много путешествовал и под конец поселился в Соединенных Штатах, своей любимой стране. В возрасте восьмидесяти лет он написал автобиографию, остроумно названную "Безрукий скрипач: ногопись", которую напечатал ногами на электрической пишущей машинке. Подобный тип пластичности нервной системы обычен для млекопитающих. Среди анатомических чудес 1940-х годов была маленькая голландская козочка, родившаяся без передних конечностей и умудрившаяся стать двуногой, на манер кенгуру.[98] Ближе – дальше Способность животных выживать без конечностей давно была по достоинству оценена биологами. Конечности можно пересчитывать, отрезать, осуществлять с ними всяческие манипуляции, оставляя при этом особь живой и даже не вскрывая ее. Конечностям некуда спрятаться от глаз биолога. Эта их незащищенность означает, что из всех механизмов, которые используются при создании организма, те, что задействованы при формировании конечностей, ныне исключительно хорошо известны. Мы многое знаем, к примеру, об одной из самых заметных их характеристик: а именно, что они торчат из нашего тела. На двадцать шестой день после зачатия у плода появляются первые признаки будущих рук: два небольших выроста, по одному с каждой стороны, сразу позади шеи. По аналогии с зачатками листьев или цветов их называют почками конечностей. Спустя день или около того чуть ниже по корпусу формируется еще одна пара почек конечностей; это будущие ноги. Подобно всем другим выступаниям на поверхности эмбриона, почки конечностей поначалу представляют собой простое разрастание эктодермы, заполненное мезодермальными клетками. Там еще ничего нет – ни костей, ни мышц, ни сухожилий, ни кровеносных сосудов. В таком аморфном состоянии зачатки конечностей пребывают в течение примерно пяти недель. К этому времени начинают формироваться слабые очертания костей – первые признаки будущей структуры. Но даже и до этого момента почка конечностей не находится в покое, так как из малюсенького бугорка она превращается в отросток около 2 миллиметров длиной. На пятидесятый день после зачатия эмбрион может скорчиться или прижать к сердцу только что сформированные ручки. На пятьдесят шестой день он дотрагивается ими до носа. Что заставляет почку конечностей вырастать в окружающее пространство? В 1948 году на этот вопрос ответил молодой американский биолог Джон Сондерс. Он заметил, что почки конечностей завершаются рядом необычных клеток. Они явно относятся к эктодерме – ткани, покрывающей весь эмбрион, но на верхушке почек приобретали другой вид: вместо своей обычной блинообразной формы становятся похожими на плотно пригнанные колонки. Сондерс окрестил эту структуру "апикальным (верхушечным) эктодермальным гребнем" и в своем желании узнать о ней больше решил ее удалить. Подобно тому как зародыши тритонов были взяты для изучения организатора, так для изучения конечностей использовали цыплят. Сондерс прооперировал двадцать два куриных эмбриона: некоторые из них совсем юные, другие постарше. В каждом случае он удалял апикальный эктодермальный гребень у одного зачатка крыла, оставляя его на другой стороне нетронутым. После операции он плотно закрывал яйцо и ждал появления цыплят. Все прооперированные крылья несли следы характерных изменений: они были в различной степени ампутированы. Цыплята, прооперированные в том возрасте, когда почка конечностей только начинала разрастаться, демонстрировали признаки наиболее суровых ампутаций: в лучшем случае у них присутствовала плечевая кость (та, что ближе всего находится к лопатке), но кроме нее ничего не было – лучевая и локтевая кости, кости запястья и пальцев – все исчезло. У цыплят, которых прооперировали позднее, остались плечевая, локтевая и лучевая кости, но отсутствовали кости запястья и пальцы. Если операция была сделана еще позднее, отсутствовали только пальцы.[99] Этот эксперимент позволил объяснить, почему некоторые дети, такие, например, как Герман Хунтан, родятся без рук или ног. Наши почки конечностей также имеют апикальные эктодермальные гребни, и иногда с ними наверняка что-то случается. Гребни на зачатках рук Германа, вероятно, начали плохо функционировать вскоре после своего появления; а может быть, они и вовсе никогда не появились. Другие разновидности встречающихся у людей деформаций напоминают менее жестокие случаи ампутаций у цыплят, когда верхушечные гребни были удалены с крыльев на более поздних стадиях развития. В бразильских штатах Минас-Жерайс, Сан-Паулу и Баия живут семьи, страдающие недугом под названием ахейроподия, от греческих слов: a – отсутствие, cheiros – рука, podos – нога. Вместо рук и ног у жертв этого расстройства короткие культи без кистей и стоп. Они передвигаются, ползая на коленях, и получили у местных жителей прозвище алейжадиньос (aleijadinhos) – маленькие калеки. Это нарушение вызвано рецессивной мутацией, видимо довольно древней, так как она проявляется у представителей более чем двадцати семейств, причем все они – португальского происхождения. Поскольку мутация носит рецессивный характер, конечности не развиваются только у тех зародышей, которые имеют две копии мутантного гена. Наличие двух копий мутантного гена – это, как правило, признак инбридинга. Первыми обследованными алейжадиньос были дети супругов из Перамы, которые доводились друг другу – здесь мнения местных жителей расходятся – либо родными братом и сестрой, либо сводными (родными по отцу или по матери), либо дядей и племянницей.[100] Ахейроподия. Алейжадиньо, Бразилия, 1970-е гг. Адемар Фрейре-Майя (Университет Сан-Паулу). Апикальный эктодермальный гребень – это скульптор, формирующий конечность. По мере того как развитие почки конечностей подходит к концу, гребень исчезает, оставляя за собой очертания пальцев рук и ног. Если гребень подвергается каким-либо нарушениям, то последствия не замедлят проявиться в окончательной форме наших конечностей. Эктродактилия "клешнепалых" из Уигтауна была следствием мутации, которая вызвала разрыв в середине гребня и, как результат, разрыв в середине формирующейся конечности. Сейчас известно, что мутации в четырех, как минимум, генах могут вызвать эктродактилию, но вполне возможно, что вскоре будет обнаружено большее их число.[101] Что же дает гребню, который представляет собой не более чем скопление клеток, такую силу в процессе формирования конечностей? Наиболее очевидным было бы предположить, что клетки, из которых образуются ткани конечностей – кости, сухожилия, кровеносные сосуды и так далее, – происходят из гребня. Однако это не так. Все эти ткани образованы мезодермой, которая лежит ниже гребня, а не самим гребнем. Только кожа есть производное эктодермы. Несомненная альтернатива этому объяснению состоит в том, что гребень важен не как источник клеток, а как источник информации: он диктует мезодерме, что та должна делать. У зародыша действие на расстоянии обычно предусматривает работу сигналов. Именно так обстоит дело в почках конечностей. Апикальные эктодермальные гребни изобилуют сигнальными молекулами, в особенности теми, которые принадлежат к одному их семейству: фибробластных факторов роста (FGF). Эксперимент, выявивший в FGF источник силы гребня, был начат с хирургического удаления – в духе Сондерса – апикального эктодермального гребня с верхушки зачатка крыла на очень ранней стадии развития. Однако оголенной почке не было позволено вырасти в обычный обрубок крыла. Вместо этого на ее верхушку, более или менее в то место, где должен находиться гребень, была помещена силиконовая бусинка, смоченная в FGF. Результатом этого эксперимента была полностью выросшая конечность, если хотите – излеченная с помощью одного белка. В человеческом геноме FGF кодируется двадцатью двумя генами, из которых по меньшей мере четыре включаются на гребне. Никто не знает, почему их там так много, но все вместе они жизненно необходимы для функционирования гребня. Было бы преувеличением сказать, что для того, чтобы вырастить руку или ногу, нужно лишь немножко FGF, но очевидно, что этого "немножко" должно хватить надолго.[102] Гребневые FGF не только способствуют пролиферации мезодермальных клеток, они также поддерживают в них жизнь. Многие клетки при малейшем негативном стимуле совершают самоубийство. В их распоряжении имеется готовый молекулярный механизм, направленный на то, чтобы помочь им разделаться с собой. Под микроскопом самоубийство клетки выглядит потрясающе. В течение примерно одного часа обреченная клетка теряет свою прозрачность, затем внезапно сморщивается и исчезает, поглощенная соседними клетками. В почке конечности FGF останавливают машину смерти; они дают клеткам основание для жизни. И все же, хотя массовое самоубийство клеток – явно плохая вещь, гибель каких-то клеток необходима для формирования пальцев рук и ног, ибо если гребень – скульптор, то гибель клеток – его резец. На тридцать седьмой день после зачатия наши конечности такие же перепончатые, как и лапы у утки. В течение следующих нескольких дней клетки перепонок отмирают (чего у утки не происходит), и наши пальцы высвобождаются. Если у плода в конечностях имеется слишком много сигнальных FGF, клетки, которые должны умереть, этого не делают. У такого плода, или, вернее, у ребенка, которым он станет, пальцы на руках и ногах остаются соединенными вместе, как если бы на них была надета рукавица из кожи.[103] Когда Сондерс удалил апикальный эктодермальный гребень с молодой почки конечности, результатом была полная ампутация последней. Но если почка была старше и крупнее, тогда исчезали только те структуры, которые были расположены ближе к концу конечности, – запястье и пальцы. Почему? За прошедшие пятьдесят лет на этот вопрос было дано немало разных ответов. Один из последних, хотя наверняка не окончательный, приводит в качестве объяснения результаты двух новейших экспериментов. Первый из них показал, что гребневые FGF проникают в мезодерму на очень небольшое расстояние, около 200 микрон (одна пятая миллиметра). В молодой почке толщина 200 микрон содержит большой процент клеток-самоубийц по отношению к общей массе; в более крупной почке эта пропорция значительно ниже. Эти различия важны, поскольку почка конечности обладает скрытой структурой. Она может выглядеть как аморфное вместилище клеток, но и только что сформированная, представляющая собой ничтожный бугорок на боку у зародыша, она включает в себя мезодермальные клетки, которые в какой-то степени уже предчувствуют свою судьбу. Одним из них предназначено стать плечевой костью, другим – пальцами, остальным – всеми промежуточными частями. По мере роста почки конечностей каждая из этих клеточных популяций, в свою очередь, пролиферирует и растет. Когда молодая почка лишается своих FGF, страдают все популяции клеток с уготованной им различной судьбой; когда подобное случается с почкой на более поздней стадии развития, пораженными оказываются только клетки, находящиеся ближе к верхушке, а вместе с ними – кисти, стопы и пальцы. Рассказ о формировании наших конечностей тесно связан с историей о самой позорной ошибке медицины XX столетия. В 1961 году австралийский врач Уильям Макбрайд сообщил о внезапном увеличении числа детей, рождающихся с деформированными конечностями. Сходные данные поступили несколько позже и от немецкого врача по фамилии Ленц. Оба медика предполагали, что дефекты развития вызваны седативным препаратом, который использовался для профилактики утренней тошноты и рвоты беременных и содержал химическое вещество фталимидо-глутаримид. Вскоре препарат приобрел печальную известность под своим торговым наименованием "талидомид". Вал новых сообщений катился по всей земле. К тому моменту, когда все закончилось, в сорока шести странах мира было зарегистрировано более 10 тысяч детей с вызванными талидомидом уродствами. Эпидемия обошла стороной лишь Соединенные Штаты, и то только потому, что некие скептики в Управлении по контролю за продуктами и лекарствами не торопились с разрешением на продажу препарата, который к тому времени был третьим в списке лекарств, пользовавшихся наибольшим спросом в Европе. Жертвы талидомида обладали очень специфическим видом деформации конечностей. В отличие от ахейроподии, их конечности не являлись следствием внутриутробной ампутации; у большинства детей были вполне сформированные кисти и стопы, равно как лопатки и тазовые кости. У них просто отсутствовало все, что должно было бы находиться между ними: лишенные длинных костей, кисти и стопы вырастали прямо из туловища. Такие конечности с виду напоминали ласты, и само состояние получило название "фокомелия", или синдром "тюленьих ласт".[104] Дети с фокомелией, случалось, рождались и прежде. Гойя (1746-1828), сочувствовавший различным проявлениям уродства и интересовавшийся ими, в своих тетрадях для зарисовок сделал очаровательный, выполненный сепией портрет молодой матери, с гордостью демонстрирующей своего изуродованного сына двум любопытным старушкам.[105] В более ранней тератологической литературе время от времени упоминаются люди с этим недугом. Виллем Фролик в своих "Таблицах..." поместил портрет известного парижского жонглера XVIII столетия Марка Казотта, страдавшего фокомелией, которого публика знала также по прозвищу Маленький Пепин.[106] Кроме того, Фролик включил в книгу изображение скелета Казотта, который и по сей день находится в парижском Музее Дюпюитрена, хотя, по горькой иронии, ноги у скелета как раз отсутствуют. Подобные случаи фокомелии могли быть вызваны какими-то химическими веществами или другими подобными агентами, но могли быть также и следствием мутаций, целый ряд которых служит причиной этого нарушения. Однако до 60-х годов XX века фокомелия оставалась редким явлением и не выходила из числа анатомических курьезов. Талидомид превратил ее в символ медицинской самонадеянности. Фокомелия. Марк Казот по прозвищу Маленький Пепин (1757-1801). Из книги Виллема Фролика "Таблицы для иллюстрации эмбриогенеза человека и животных в норме и в аномалиях", 1844-1849 (Библиотека Уэллком, Лондон). Каким образом талидомид оказывает свое столь разрушительное воздействие? Полная библиография работ по этому препарату и его последствиям насчитывает около 5 тысяч специальных исследований, но, несмотря на это, механизм его воздействия все еще до конца неясен.[107] Некоторые детали все же понятны. Талидомид – тератоген, а не мутаген: дети жертв талидомида имеют не больше шансов на появление этого уродства, чем все остальные люди. Вместо этого талидомид задерживает пролиферацию клеток. Принимаемый беременными в то время, когда они наиболее подвержены симптомам утреннего недомогания (от тридцать девятого до сорок второго дня после зачатия), он циркулирует по всему организму матери и ребенка и останавливает деление клеток. Это происходит как раз в тот момент, когда формируются первые популяции клеток, те самые, которые в дальнейшем образуют отдельные части конечностей у ребенка. В зависимости от конкретных сроков продолжительности этого воздействия зачатки одной или нескольких костей прекращают свой рост, в результате чего образуется конечность с недостающими частями. Предполагается также, что талидомид может препятствовать, вполне прямым способом, работе фибробластных факторов роста, которые так необходимы для развития почки конечностей, однако вопрос этот пока что сохраняет чисто гипотетический характер. Каков бы ни был modus operandi[108] талидомида, этот, по определению, могущественный препарат по-прежнему сохраняет свою притягательность для фармацевтов. Запрет на его применение потихоньку нарушается, так как поступают все новые предложения по поводу его использования против ряда заболеваний. В Южной Америке его употребляют для лечения проказы. Это значит, что дети с изуродованными конечностями с неизбежностью появятся вновь, так как препарат, возможно, будут принимать женщины, еще не подозревающие о своей беременности. Стремление к десятичности Метрическая система, имеющая в своей основе десять чисел, существует лишь потому, что у ученых мужей из Французской академии, разработавших эту систему, было на руках по десять пальцев, на которых они, предположительно, учились считать. Если бы математикой занялись свиньи, они, наверное, измеряли бы свои помои в единицах Международной системы, которая основывалась бы на восьми числах, так как у них имеется по четыре пальца на каждом копыте. У лошадей приходится один палец на конечность, У верблюдов – два, у слонов – пять, у морских свинок, однако, имеется по четыре пальца на передних конечностях и по три – на задних. У кошек и собак по пять пальцев на передних и задних ногах, но один из них очень маленький, рудиментарный. За исключением некоторых разновидностей лягушек и дельфинов, называемых вакита, у большинства позвоночных редко встречается на одной конечности больше пяти пальцев.[109] Почему так происходит, абсолютно неясно. Вовсе не потому, что лишние пальцы невозможно создать. У млекопитающих всех видов иногда встречаются дополнительные пальцы, но как исключение, а не правило. Сенбернары, пиренейские овчарки, ньюфаундленды и другие крупные собаки особенно подвержены появлению дополнительных пальцев на каждой ноге, причем обычно у них удваивается тот самый рудиментарный палец. У Эрнеста Хемингуэя все кошки были с полидактилией, и их многопалые потомки до сих пор живут на территории его дома в Ки-Уэсте. Пятнадцать процентов уличных кошек в Бостоне характеризуются полидактилией (у некоторых насчитывается до десятка лишних пальцев), а вот в Нью-Йорке среди бродячих кошек вы таких не встретите. Существует немало линий мышей с полидактилией: одну из них назвали "сасквоч" в честь снежного человека, у остальных более прозаичные наименования, вроде "двоеногих" или "лишнепалых". Американский генетик Сьюэлл Райт однажды вывел морскую свинку с сорока четырьмя пальцами на передних и задних конечностях, но долго она не протянула.[110] У многих людей также имеются лишние пальцы. Примерно 1 на 3000 европеоидов рождается с дополнительными пальцами на руках или ногах (либо и на тех и на других); у африканцев это соотношение составляет 1:300. В принципе может удваиваться любой палец, но у африканцев им обычно бывает мизинец, а у европейцев – большой палец. Полидактилия – это, как правило, генетическая аномалия, часто передающаяся по доминантному типу и встречающаяся в некоторых семьях во многих поколениях. Задолго до появления Грегора Менделя французский математик Пьер-Луи Моро де Мопертюи (1698-1758) описал наследование полидактилии у предков и потомков берлинского врача по имени Якоб Руэ. У его бабушки было по шесть пальцев на каждой руке и ноге, равно как у его матери, у него самого, у троих из его семи братьев и сестер и у двух из его пяти детей. Другие ученые приводили примеры еще более внушительных родословных с полидактилией. Так, в 1931 году русский генетик Е.О. Манойлов опубликовал сообщение об одном грузине с полидактилией, Вячеславе Михайловиче де Камио-Сципионе, который, по его словам, мог проследить свое происхождение от многопалых предков на протяжении шести поколений.[111] Если апикальный эктодермальный гребень обеспечивает рост наших конечностей в пространстве, за пределами тела, то другая, в равной мере незаметная часть почки конечностей следит за тем, чтобы у нас было нужное число и правильный набор пальцев. Это открытие опять-таки было сделано Джоном Сондерсом вместе с его сотрудницей Мэри Гасселинг. Они обнаружили, что если пересадить кусочек мезодермы с хвостового конца одной из куриных почек конечностей на головной конец другой (так, чтобы почка имела два хвостовых конца с противоположной ориентацией по отношению друг к другу), то в результате у курицы появится крыло с двойным набором обычных пальцевых структур. Самое замечательное в этом было то, что полученные в результате эксперимента крылья были похожи на одну, особенно редкостную разновидность полидактилии, встречающуюся у людей. Они напоминали конечности людей, которые не просто характеризовались добавочными пальцами, а практически обладали полным дубликатом пальцев руки или ноги, так что общее их число на одной конечности могло доходить до десяти. Крылья с полидактилией имели своеобразное зеркальное расположение пальцевых структур, точно такое же, как и на продублированных кистях у людей. Если пронумеровать каждый палец, так что большой палец будет по порядку 1-м, указательный – 2-м, средний – 3-м, безымянный – 4-м и мизинец – 5-м, то формула для нормальной пятипалой кисти будет "12345", а для руки с двойным набором пальцев: "5432112345". Это совершенно удивительное явление, своеобразный анатомический палиндром. Зеркальная полидактилия. Из книги Уильяма Бейтсона "Материалы для изучения изменчивости", 1894 (Империал-колледж, Лондон). Сондерс и Гасселинг назвали открытый ими кусочек мезодермы, обладающий столь могучими свойствами, зоной поляризующей активности, или ЗПА (ZPA). Считают, что это источник морфогена. В самом центре, где концентрация его наиболее велика, этот морфоген заставляет необученную мезодерму становиться мизинцем; чуть поодаль более низкие концентрации индуцируют безымянный, средний и указательный пальцы, поочередно, а на противоположном конце конечности будет сформирован большой палец.[112] Этот отчет о том, как большинство из нас получает свои пять пальцев, наводит на мысль о существовании организатора. Подобно ему, ЗПА обладает необыкновенным талантом призывать к порядку свое окружение. И, как в течение многих лет продолжались поиски морфогена организатора, так в последние годы ищут морфоген ЗПА. Почти наверняка это будет сигнальный белок, вероятно – какой-нибудь из уже известных, член большого семейства сигнальных белков, повсеместно функционирующих в эмбрионе. Но почки конечностей содержат множество таких белков, и пока трудно установить, который из них является собственно морфогеном. За последние годы появилось несколько кандидатов на эту роль, полностью отвечающих всем необходимым требованиям. Один из них – это соник-хеджхог.[113] Соник-хеджхог появляется в почке конечности там и только там, где и должно находиться морфогену: в мезодерме хвостовой части, что в точности совпадает с положением ЗПА Сондерса и Гасселинг. Он также занимается тем, что и должен делать морфоген: формированием конечностей. Крыльям цыпленка можно придать новые, невероятные формы, в том числе и такие, которые удваивают нормальный набор пальцев и дают его зеркальное отражение, – все это за счет изменения концентрации соника в почке. И наконец, существуют мутанты. Мутации по меньшей мере в десяти генах приводят к полидактилии у людей, и все они как будто бы влияют тем или иным способом на роль соника в конечности. Но, как мы уже говорили в предыдущей главе, соник-хеджхог не просто определяет, сколько именно пальцев у нас вырастет на руках и ногах. Он также разделяет наш мозг, решает, как широко будут расставлены наши глаза, и регулирует много других важных деталей. Это безнадежно неразборчивая молекула. Если бы можно было пронаблюдать за активностью гена соник-хеджхога в течение некоторого времени, как при замедленной фотосъемке, мы бы увидели, что его деятельность охватывает весь развивающийся организм зародыша или плода и что он включается или выключается то в одном формирующемся органе, то в другом. Перед механизмами, ответственными за эти процессы, стоит грандиозная по сложности задача, и они практически нигде, учитывая могущество соника в определении судьбы клеток, не имеют права на ошибку. Эти механизмы – транскрипционные факторы, или "молекулярные переключатели". Некоторые из них осуществляют контроль за соником. Если мутации выводят их из строя, соник начинает включаться в тех частях почки конечностей, где обычно не должен этого делать, в результате чего у нас появляются лишние пальцы на руках и ногах. Другие мутации не выводят из строя транскрипционные факторы, а скорее уничтожают регуляторные элементы, с которыми они связываются. Результат, однако, будет тем же самым: смешение градиентов морфогена и ошибки в формировании пальцев. Мутации, приводящие к полидактилии, ослабляют контроль со стороны соник-хеджхога, изменяя баланс сил в пользу его повсеместного распространения. Другие мутации обладают прямо противоположным эффектом и вообще не дают сонику появляться в зачатке конечности. Самый яркий пример такой мутации – это выведение из строя самого гена соника. Мыши, у которых отсутствует соник, в добавление к другим многочисленным дефектам, вообще не имеют лап. Это удивительно напоминает нарушение, о котором уже говорилось выше: ахейроподию, или ту аномалию, которой страдают алейжадиньос. Действительно, есть доказательства, хотя и не бесспорные, что приводящая к ахейроподии мутация выводит из строя регуляторный элемент, необходимый для присутствия соника в конечности. Это перечисление мутаций дает лишь очень отдаленные представления об истинной сложности процессов генной регуляции у зародыша.[114] Например, факт включения или невключения гена в данной клетке зависит от того, какие транскрипционные факторы содержит ее ядро, а их присутствие, в свою очередь, зависит от еще одних транскрипционных факторов и так далее. На первый взгляд, подобного рода иерархии как будто вовлекают нас в бесконечную цепь таких зависимостей, когда задача по организации порядка попросту перекладывается на вышестоящие структуры, которые, в свой черед, тоже подчиняются чьим-то приказам. Но дилемма эта скорее кажущаяся, нежели реальная. Формирование эмбриона – не однократный процесс. Конкретное присутствие соника в ЗПА определяется отчасти активностью Hox-генов в мезодерме туловища, из которой вырастают конечности. Но приказы относительно пространственного расположения частей, отдаваемые этими генами, довольно расплывчаты; в задачи соника входит их дальнейшее уточнение. Помимо соника, конечно же, существуют и другие детализирующие уровни, которые осуществляют упорядочивание структуры в более мелких масштабах, причем каждый из этих уровней должен вести постоянные, подробные переговоры, природа которых нам пока что не вполне понятна. Эта картина последовательных уровней переговоров и контроля может показаться невообразимо сложной. Но на деле она недостаточно сложна, так как ей не удается покорить одну из наиболее общих характеристик программы развития зародыша: его нелинейность. Выше я утверждал, что приводящая к ахейроподии мутация препятствует появлению соника в конечности. И тем не менее я начал эту главу с предположения, что внутриутробные ампутации конечностей разной степени тяжести, проявляющиеся у новорожденных, вызваны нарушениями в апикальном эктодермальном гребне и продуцируемых им фибробластных факторах роста. В этом можно было бы усмотреть противоречие, но оно возникает только в том случае, если мы думаем, что сигналы различных конечностей не зависят друг от друга, тогда как в действительности это не так. Ибо одна из наиболее важных ролей соник-хеджхога состоит в том, чтобы поддерживать и формировать апикальный эктодермальный гребень с его фибробластными факторами роста, а одна из самых важных ролей апикального эктодермального гребня – поддерживать и контролировать продукцию соник-хеджхога в зоне поляризирующей активности. Этот двусторонний обмен информацией не менее рискован, чем перекидка предметами между двумя жонглерами, стоящими на разных концах сцены. Подобное взаимовлияние повсюду присутствует в развивающемся эмбрионе и в корне меняет наши взгляды на процессы роста и развития. Мы начинаем с представлений о линейных путях приказов и контроля и о простом плане строения, а потом пытаемся распутать узел. И когда, как в случае с конечностями, мы действительно начинаем видеть очертания программы развития, она однозначно напоминает запутанный клубок сетей, совершающих головокружительные круговороты во времени и пространстве. Сети в данном случае обеспечивают одно простое правило: если мы начинаем пересчитывать пальцы на руках и ногах, то обычно заканчиваем числом двадцать. Кисти, стопы и предки Примерно на тридцать второй день после зачатия, когда почка конечности у человека уже довольно велика, ее аморфная ткань начинает дифференцироваться. Появляются еще неясные предшественники костей: конгломераты мигрировавших вместе клеток. Научный термин, обозначающий этот процесс, – "конденсация". Он дает представления о способе образования костей: тихом и незаметном, как выпадение росы. Первыми "конденсируются" кости, ближе расположенные к телу: плечевая кость в руке и бедренная в ноге. Со временем конгломерация медленно движется вдоль почки конечностей. Плечевая кость разделяется на два новых длинных и тонких конденсата, каждый из которых будет отращивать свою структуру: лучевую и локтевую кости. Они, в свою очередь, разделяются и почкуются, образуя клеточную дугу, из которой будут сформированы двадцать семь костей запястья и ладони. На тридцать восьмой день после зачатия концевая часть каждой почки конечностей уплощается и расширяется наподобие весла. На этом "весле" вскоре появляются параллельные желобки – по четыре на каждом кончике, с пятью расположенными между ними конденсатами клеток. Это будущие кости пальцев рук и ног.[115] Форма конденсатов зависит в конечном итоге от координатной сетки, которая устанавливается сигнальной системой конечностей. Но, как и всегда у зародыша, эта информация должна быть переведена на клеточный уровень. Hox-гены выполняют эту функцию для продольной, от головы до хвоста, оси эмбриона, а также для конечностей. По мере роста почки конечностей начинает проявляться действие некоторых из тридцати девяти Hox-генов, причем в виде сложных, перекрывающих друг друга паттернов. Они, по-видимому, вовлечены в некие комбинаторные манипуляции, аналогичные тем, которые используются при формировании позвонков. Дети, рожденные с единственной дефектной копией гена Hoxa13, имеют короткие большие пальцы ног и изогнутые мизинцы. Другая Hox-мутация у человека вызывает синполидактилию, когда дополнительные пальцы на руках и ногах срастаются вместе. Особенно разрушительная мутация, уничтожающая за один раз не менее девяти Hox-генов, приводит к рождению младенцев с отсутствующими костями предплечья, а также с отсутствующими пальцами на руках и ногах.[116] Конечности – это далеко не единственные отростки, на которые воздействуют Hox-гены. У детей с мутациями Hox-генов, поражающими конечности, проявляется также тенденция к недоразвитию гениталий. В самых тяжелых случаях у младенцев мужского пола обнаруживаются всего лишь рудименты мошонки и пениса. Многие молекулы, вовлеченные в процесс создания конечностей, задействованы также и при формировании гениталий, поэтому нас не должно удивлять, что при некоторых мутациях страдают и те и другие органы – широко распространенные слухи о положительной корреляции между длиной стопы и пениса, как ни странно, также оказываются верны, по крайней мере отчасти. Однако судить по размеру ноги о мужских достоинствах все же нельзя, так как корреляция хотя и статистически достоверна, но очень незначительна.[117] Кроме того, в тех данных, которые по этому поводу имеются, рассматривается длина "вытянутого", а не эрегированного члена, хотя последний признак в качестве переменной представляет наибольший интерес. И все же, когда французы называют пенис "третьей ногой", "королевской ногой" или "мизинцем", а англичане – "лучшей ногой из трех", "нижней ногой" или "средней ногой", не говоря уж об их знаменитом "ярде", который, как известно, равен трем футам,[118] они оказываются ближе к истине, чем сами о том догадываются. Hox-гены могут рассказать также о нашем происхождении. Откуда берутся пальцы? Может показаться, что на этот вопрос есть простой ответ. Наши конечности, во многих отношениях такие пластичные, являются аналогами структур, благодаря которым движутся рыбы в морской стихии, т.е. рыбьих плавников. Но у рыб нет пальцев. Можно предположить, что лучи – тонкие костные образования, которые расправляют плавник наподобие веера, – это и есть аналог пальцев у рыб. Однако лучи рыб и пальцы четвероногих сформированы из совершенно различных видов кости – и это, как считают анатомы, достаточное основание, чтобы заключить, что между ними нет ничего общего. Большинство рыб находятся лишь в очень отдаленном родстве с четвероногими, так что, возможно, отсутствие у них пальцев не должно вызывать удивления. Но и наши ближайшие родственники из числа рыб мало чем могут помочь. Существуют кистеперые рыбы: австралийский рогозуб, который проводит большую часть времени, зарывшись в пересохший ил на отмелях, и целакант, обитающий в глубинах Индийского океана. Сегодня их называют живыми ископаемыми, намекая тем самым на то, что их родичи изобиловали на Земле около 400 миллионов лет назад, а теперь их потомки чрезвычайно редки. Некоторые ископаемые кистеперые рыбы имеют плавники, удивительно напоминающие наши конечности. У них как будто даже есть структуры, родственные плечевой, лучевой и локтевой костям. У них в изобилии имеются также более мелкие кости, которые слегка напоминают пальцы и сформированы из нужного вида кости. Но расположение этих маленьких косточек в корне отличается от того стандартного, которое характерно для набора пальцев всех четвероногих и принадлежит им по праву рождения. Можно выкручивать и переворачивать плавники кистеперых, как кому вздумается, но зачатки наших рук и ног от этого все равно не появятся. Отсюда напрашивается, по-видимому, неизбежный вывод: если у рыб нет пальцев, а у четвероногих они есть, значит, где-то в процессе эволюции, около 370 миллионов лет назад, было создано нечто новое. Но как? Зачатки плавников у рыб очень сходны с почками конечностей четвероногих. У них имеются апикальные эктодермальные гребни, фибробластные факторы роста, зоны поляризующей активности, соник-хеджхог и полный набор Hox-генов, которые сложным образом включаются и выключаются по мере того, как почка реализует свой рост в пространстве. Это говорит нам (хотя для нас это не новость) о том, что плавники, ноги и крылья, столь различающиеся по форме и функциям, развились из какого-то пра-отростка, который торчал сбоку у давно вымершей пра-рыбы. Но нас в первую очередь интересуют различия. Одно такое различие относится к деталям работы Hox-генов. На ранних стадиях развития либо плавника, либо конечности Hoxd13 включается в хвостовой половине почки, как раз около зоны поляризующей активности. Но по мере роста плавников и конечностей начинают выявляться различия, у рыб Hoxd13 царствует недолго: зачатки плавников растут, а ген исчезает. У мышей, однако, Hoxd13 остается и проявляет свою активность по дуге, которая проходит по самому наружному краю почки. Похоже, что он занимается чем-то новым, чем-то таким, чего у рыб не происходит и никогда не происходило: Hoxd13 формирует пальцы. Подобные различия (которые справедливы также в отношении других Hox-генов) придают мутациям Hox-генов более глубокий смысл. Если в своем последнем всплеске деятельности Hoxd13 формирует пальцы, тогда можно было бы ожидать, что мышь с уничтоженным геном Hoxd13 окажется беспалой. Это будет мышь, у которой снят всего только один из многих слоев изменений, накопленных в процессе сотен миллионов лет эволюции. Ее лапки будут воплощенным атавизмом, так как сама она на шаг отошла от четвероногих и приблизилась на это же расстояние к рыбам. Однако, как оказалось, мыши, мутантные по гену Hoxd13, отличаются вовсе не отсутствием пальцев, а их избытком. Правда, пальцы у них маленькие и уродливые, но их не пять, а шесть. Такой результат, мягко говоря, озадачивает. Он, похоже, означает, что где-то в нашей эволюционной истории было некое существо, у которого не только имелись пальцы на руках и ногах, но и в большем, чем у нас да и почти у всех остальных ныне живущих четвероногих, количестве.[119] Мысль о том, что полидактилия (будь она у мышей, морских свинок, собак, кошек или людей) – это атавизм, не нова. Ее высказал Дарвин в первом издании своей книги "Изменение домашних животных и культурных растений" (1868), где он пытался развить теорию наследования, в которой так нуждалась эволюция путем естественного отбора. "Когда ребенок напоминает своих дедушек и бабушек больше, чем собственных родителей, – писал он, – наше внимание на этом не слишком фиксируется, хотя в действительности факт этот довольно-таки замечателен. Но если ребенок похож на совсем дальних родственников или даже на какого-то далекого сородича по боковой линии, тогда мы приписываем это происхождению всех членов семьи от общего предка и испытываем справедливую степень изумления". Это, безусловно, так, но дарвиновские рассуждения, на которых основан его довод о том, что полидактилия у человека – это атавизм (или, по его терминологии, реверсия), остаются, как минимум, туманными. У саламандр, отмечал он, могут отрастать пальцы после ампутации; и, как он где-то читал, то же может происходить и с дополнительными пальцами у людей, хотя обычные пальцы лишены таких свойств. Тогда добавочные пальцы можно было считать проявлением примитивной способности к регенерации и, следовательно, атавизмом. Это был сомнительный аргумент, и он не мог пройти незамеченным. Немецкий анатом Карл Гегенбауэр подчеркнул, что пальцы у человека, дополнительные или другие, не способны к регенерации после ампутации, а хоть бы и были способны, что из того? Полидактилия не может быть атавизмом без многопалого предка, а у всех известных четвероногих, живых или мертвых, по пять пальцев. В следующем издании "Изменения..." семью годами позже Дарвин, всегда отличавшийся критическим мышлением, признал ошибочность своего суждения: полидактилия не атавизм, а просто уродство.[120] Но Дарвин в конце концов все же, наверное, оказался прав – хотя его доводы и были неверными. В последние десять лет или около того представления о происхождении четвероногих претерпели радикальную ревизию. Из скал вышли новые ископаемые и явили миру странные вещи. В противовес всем ожиданиям, у людей – и у всех ныне живущих четвероногих – были многопалые предки. Самыми первыми бесспорными представителями четвероногих в ряду ископаемых предков считаются три зверя из девонских болот, живших около 360 миллионов лет назад: Acanthostega, Turlepreton и Ichthyostega. Все они, на современный четвероногий стандарт, имеют до странности большое количество пальцев: у Acanthostega[121] их восемь на каждой лапе, у Turlepreton и Ichthyostega – либо шесть, либо семь. Внезапно все переменилось, и теперь мутантные по гену Hoxd13 мыши и мутанты-млекопитающие всех сортов с полидактилией могут действительно выглядеть как живые воспоминания о прошлом, только это будет память о древних амфибиях, а не рыбах. Возможно, чтобы вернуться к плавнику рыб, нужно побольше повозиться с генетикой и снять большее количество эволюционных слоев. Так, по крайней мере, кажется. Мыши, мутантные по гену Hoxd13, могут демонстрировать полидактилию, но мыши, мутантные по этому и другим Hox-генам, т.е. дважды и трижды мутантные, совсем лишены пальцев. Выглядит так, что когда специалисты по генетике развития один за другим убирают Hox-гены из геномов своих мышей, они поворачивают вспять историю в своих лабораториях и повторяют одиссею длиной 500 миллионов лет: путь от беспалой рыбы к девонским амфибиям, у которых пальцев было в избытке, заканчивающийся в итоге нашей привычной пятерней. Глава V Плоть от плоти моей, кость от кости моей [о скелете] Летальная скелетная дисплазия. Мертворожденный младенец, Амстердам, ок. 1847 г. Из книги Виллема Фролика "Таблицы для иллюстрации эмбриогенеза человека и животных в норме и в аномалиях", 1844-1849 (Библиотека Уэллком, Лондон). Около 1896 года на мысе Доброй Надежды появился китайский матрос по имени Арнольд. Нам мало что о нем известно, и портреты его до наших дней не дошли. Однако мы можем предположить, что он был невысок ростом, с сильно выступающим лбом. Еще он был слаб на голову – не в смысле интеллекта, а потому что верхние кости черепа у него отсутствовали. Вероятно, у него не было ключиц, а если и были, то не доставали до лопаток. И если бы кто-то, стоящий сзади, толкнул его, плечи Арнольда могли бы легко сложиться, как книжка, перед грудью. У него, возможно, были лишние зубы, а может, их и вовсе не было. Мы можем высказать столько догадок потому, что Арнольд был исключительно плодовитым и многие из его многочисленных потомков обладают вышеописанными чертами. Прибыв в Кейптаун, он обратился в мусульманство, завел семерых жен и погрузился в жизнь капско-малайского общества. Капские малайцы – это люди в основном яванского происхождения, вобравшие в свой генетический состав примесь народов сан, кхой, западных африканцев и мальгашей. Традиционно занимающиеся ремеслами и рыболовством, капские малайцы создали элегантные фронтоны особняков в стиле Капская Голландия (Кейп-Датч) для владельцев южноафриканских винодельческих поместий, внесли в национальную кухню специфический восточный аромат и обогатили язык африкаанс небольшим количеством малайских слов наподобие "пайсанг"[122]. Проведенное в 1953 году обследование выявило мутацию отсутствия костей у 253 потомков Арнольда. В 1996 году мутация распространилась среди тысячи человек. К счастью, отсутствие ключиц и местами мягковатый череп не представляют большой опасности для здоровья. Клан Арнольда и в самом деле вполне справедливо гордится своим прародителем и дарованной им мутацией.[123] Формирование костей Возможно потому, что кости последними из наших бренных останков обращаются в прах, мы думаем о них как о чем-то неживом. Но они таковыми не являются. Подобно сердцу и легким, кости постоянно формируются и разрушаются, как того и требует цикл созидания и деструкции. И хотя они кажутся такими отличными от остального тела, они происходят из тех же самых эмбриональных тканей, которые создают покрывающую их плоть. В самом полном смысле слова можно сказать, что кость – это трансформированная плоть. Тесная взаимосвязь между костью и плотью может быть продемонстрирована на примере происхождения образующих их клеток. Большая часть костных клеток – остеобластов – берет свое начало в мезодерме, той же самой зародышевой ткани, из которой формируются также соединительная ткань и мышцы. Взаимосвязь проявляется и в том, как образуются кости. Глубоко внутри каждой кости сохраняются остатки создавших ее клеток. Различные кости нашего организма формируются двумя разными способами. Плоские кости, такие как кости черепа, начинают складываться у зародыша как слои остеобластов, секретирующих белковую основу (матрикс). На этой основе образуются зубчики фосфата кальция, которые заключают клетки в оболочку. По мере роста кости добавляются новые слои остеобластов, каждый из которых в свою очередь инкапсулируется за счет собственной секреции. У длинных костей наподобие бедренной процесс идет несколько по-иному. Их формирование начинается с конденсаций клеток, заметных в развивающихся конечностях зародыша. Эти клетки, также производные мезодермы, называются хондроцитами, и они продуцируют хрящевую ткань. Хрящ – это шаблон для будущей кости, который лишь позднее станет добычей остеобластов. При своем первом появлении шаблон похож на кость своей формой, но не структурой. Одна из молекул, контролирующая клеточные конденсаты, – это костный морфогенетический белок (bone morphogenetic protein – BMP). Для удобства можно говорить о нем как об одной молекуле, хотя в действительности их целая семья. Подобно многим другим семействам сигнальных молекул, BMP обнаруживаются в самых неожиданных местах зародыша. Именно BMP задолго до формирования костей приказывают некоторым зародышевым клеткам становиться животом, а не спиной. Однако на более поздних стадиях развития эмбриона BMP появляются в скоплениях клеток, которые в будущем станут костями. У детей и взрослых они возникают в местах переломов костей. Поразительное свойство BMP состоит в их способности вызывать индукцию кости практически повсюду. Если сделать крысе подкожную инъекцию BMP, у нее сформируются костные разрастания совершенно отдельно от скелета, но со структурой обычной кости, вплоть до наличия костного мозга. Для создания кости недостаточно, чтобы недифференцированные клетки сконцентрировались в нужном месте и в нужном количестве. Клетки должны превратиться в остеобласты и хондроциты. Возвращаясь к метафоре, которую я уже употреблял ранее, они должны скалькулировать свою судьбу. Ген, отвечающий за судьбу остеобластов, тот же самый, что вызвал появление синдрома "головы Арнольда".[124] Этот ген кодирует транскрипционный фактор под названием CBFA1. Можно подумать, что CBFA1 не имеет большого значения, поскольку в результате его мутации обнаруживается недостаток всего лишь нескольких костей. Однако все потомки Арнольда гетерозиготны по этой мутации: только один из двух генов CBFA1 является носителем мутантной копии. Мыши, гетерозиготные по мутации того же гена, также отличаются неокостеневшими головками и отсутствием ключиц. Но мыши, гомозиготные по мутантному гену, практически не имеют костей. Вместо скелета у них имеются лишь хрящевые тяжи, пронизывающие весь организм, а мозг у них защищен всего только слоем кожи. Они могут сгибаться во всех направлениях, но это им не нужно, так как они мертвые. Бескостные мыши умирают в течение нескольких минут после рождения от удушья из-за того, что у них нет грудной клетки для поддержки легких.[125] По одной из странных причуд истории генетики Южная Африка является также родиной мутации, которая по своему действию противоположна той, что возникла у Арнольда, так как вызывает не дефицит костного вещества, а, напротив, его избыток. Вместо дыр из-за отсутствия костей в черепе жертвы этой второй мутации обладают крайне массивными черепами. При рождении мутация никак себя не обнаруживает. Толстые кости черепа и грубые черты лица, являющиеся характерными для этого синдрома, развиваются только с возрастом. В отличие от мутации утраты костей, мутация избытка костной ткани нередко является летальной. Ее носители обычно умирают в зрелом возрасте от судорог, так как дополнительные костные образования пережимают некоторые жизненно важные нервы. Опять-таки, в отличие от мутации отсутствия костей, мутация толстых костей черепа рецессивна и выражена лишь у небольшой горстки людей, жителей одной деревни, которые заключают браки между собой и ведут свое происхождение от одного голландца, основавшего в XVII веке поселение Капская колония. Вызывающая это нарушение мутация выводит из строя совершенно другой, чем CBFA1, ген. Сам белок носит название склеростина вслед за вызываемым им синдромом – склеростозом.[126] Считается, что он является ингибитором молекул BMP – возможно, связывая их, а потом выводя из строя. Именно так действуют многие ингибиторы BMP. На ранних стадиях зародышевого развития молекулы организатора наподобие ноггина ограничивают действие BMP как раз таким способом. В самом деле, мутации ноггина приводят к еще одному синдрому избыточного роста костной ткани, поражающему только пальцы рук и заставляющему их с возрастом срастаться вместе, делая их неподвижными.[127] Нарушения, связанные с избытком кости, иллюстрируют необходимость того, что организм должен держать семейство BMP под контролем. И все же сросшиеся пальцы и даже толстые кости черепа – это относительно слабые проявления способности BMP продуцировать костную ткань в самых неподходящих местах. Есть еще одно заболевание, демонстрирующее степень нарушений, которые могут произойти, если остеобласты распространятся по всему организму и начнут образовывать кости где им вздумается. Этот недуг называется прогрессирующей окостеняющей фибродисплазией (fibrodisplasia ossificans progressive), или ПОФ. Это редкое заболевание: по подсчетам, число людей, страдающих им во всем мире, составляет около 2500, но специалисты в этой области наверняка знают о существовании лишь нескольких сотен больных. Самой известной жертвой недуга был американец по имени Гарри Реймонд Истлэк. Прогрессирующая окостеняющая фибродисплазия. Гарри Истлэк, США, 1953 г. Линда Линдгрен, Лос-Анджелес, и Гретхен Уорден (Музей Мюттера, Филадельфия). В 1935 году Гарри, которому тогда исполнилось пять лет, сломал ногу, играя с сестрой. Перелом сросся неудачно, и у мальчика навсегда осталась искривленная левая бедренная кость. Вскоре после этого случая у него также выявилось нарушение подвижности в тазобедренном и коленном суставах, что, однако, не было следствием первоначального перелома, а вызывалось костными отложениями, сформировавшимися на отводящей и четырехглавой мышцах. Гарри рос, а костные образования распространялись по всему телу. Они появились в ягодицах, на груди и шее, а также на спине. К 1946 году его левая нога и тазобедренный сустав полностью окостенели; туловище приобрело постоянный наклон под углом 30°; костные соединения образовали мост вдоль всего позвоночника, а мышцы на спине превратились в костные пластины. Делались попытки удалять эти образования хирургическим путем, но они отрастали снова и становились еще тверже и обширней. В возрасте двадцати трех лет он был помещен в специальную клинику для хронических больных. Он умер в 1973 году. К этому времени у него срослись челюсти, и он уже не мог разговаривать. По просьбе Гарри Истлэка его скелет передали для научных исследований, и теперь он стоит в витрине Мюттеровского музея в Филадельфии. Изобилующий дополнительными костными тяжами, распорками и выростами, которые оплели конечности и грудную клетку, его скелет выглядит так, как будто обычный костяк сорокалетнего человека поместили внутрь другого скелета, формирование которого уже началось, но вышло из-под контроля. Причина болезни в общих чертах понятна. Травмы тканей вызывают у больных ПОФ ненормальную реакцию. Вместо того чтобы лечить синяки и растяжения с помощью соответствующих тканей, в ход идут остеобласты и образовавшиеся участки превращаются в кость. Это типичные проявления ошибок в продукции BMP или контроле над ними, но причина этих сбоев, т.е. сама мутация, до сих пор не обнаружена. Поиски ее могут оказаться долгими. У больных ПОФ редко рождаются дети, так что ген, являющийся первопричиной заболевания, нельзя определить путем изучения длинных родословных пораженных недугом семейств.[128] Прогрессирующая окостеняющая фибродисплазия. Гарри Истлэк (1930-1973). Как растут кости Скелет новорожденного младенца представляет собой произведение филигранной красоты и сложности; череп его по мягкости сравним с листом картона, но по толщине уступает ему, а бедренные кости тоненькие, как ствол карандаша. Когда ребенок вырастет и превратится во взрослого, все вышеупомянутые параметры изменятся. Бедренные кости в диаметре сравняются с хоккейной клюшкой и смогут, по крайней мере в большинстве случаев, выдерживать ее удары. Кости черепа по толщине сравняются с тарелкой и станут способны защитить мозг своего владельца, даже если он займется игрой в регби или станет участником другого, не менее любопытного действа, распространенного среди австралийских аборигенов, когда они, по заведенному обычаю, бьют друг друга по голове здоровенными палками.[129] Что же заставляет кость вырастать до нужного размера? В 1930 году молодой американский ученый Виктор Чендлер Твити попытался получить довольно-таки прямой ответ на этот вопрос. Следуя в русле немецкой школы "Механики развития" ("Entwicklungsmechanik"), Твити взялся изучать два вида саламандр: тигровую саламандру и пятнистую саламандру. Эти близкородственные животные различаются в одном, очень важном отношении: тигровые саламандры примерно вдвое больше пятнистых. Эксперименты, выполненные на них Твити, отличаются такой элегантностью, простотой и смелостью, что и спустя семьдесят лет фигурируют в большинстве учебников. Твити начал с того, что стал отрезать ноги у саламандр. Итальянский ученый Ладзаро Спаланцани из Скандиано еще в 1768 году установил, что у саламандр могут при необходимости отрастать ноги и хвост. С тех пор многие тысячи этих созданий ради науки лишались своих конечностей. Одна из неудачниц двадцать раз расставалась с ампутированной ногой – и всякий раз отращивала ее снова. По одному шутливому замечанию, которое распространено среди ученых, счастье состоит в том, чтобы найти удачный эксперимент и повторять его снова и снова. Твити, однако, был более изобретателен. Когда у саламандр зажили культи отрезанных конечностей и их ткани реорганизовались в зачатки новых конечностей, он снова взялся за нож и отрезал их. Затем он взял ампутированные почки конечностей одного вида и пересадил их на культи другого. Вопрос состоял в том, до какого размера будут расти чужеродные конечности. На то, по логике Твити, имелось две возможности. По мере того как пересаженные почки будут превращаться в ноги, они могут либо приобрести свойства хозяина, либо сохранить свои собственные. В первом случае почка конечностей пятнистой саламандры, пересаженная на культю тигровой, разовьется в мощную ногу, соответствующую размерам тигровой саламандры. Или, в ином случае, почка конечностей пятнистой саламандры просто вырастет в небольшую ногу, как это с ней обычно и происходит. В результате получится тигровая саламандра с тремя большими ногами и одной маленькой, пересаженной, короче говоря, кривобокая саламандра. Сам Твити ожидал, что чужеродные ноги вырастут столь же большими, как и обычные ноги саламандры-хозяина. В 1930-х годах уже было известно, что огромное влияние на процессы роста оказывают гормоны. Один из них, продуцируемый гипофизом, даже получил название гормона роста, и клиницисты говорили о людях с его избытком или дефицитом как о "гипофизарных" гигантах и карликах. Если тигровые саламандры были крупнее пятнистых, то происходило это наверняка потому, что первые имели больше гормона роста (или чего-то наподобие него), чем их более мелкие родственники. Чужеродные конечности должны реагировать на концентрацию гормонов хозяина в той же степени, что и обычные конечности, и, в соответствии с ней, становиться большими или маленькими. Контроль над ростом будет в этом смысле глобальным, когда все ткани должны подчиняться единому набору инструкций, циркулирующих по всему телу. Нет сомнений, что гормоны действительно играют роль, причем жизненно важную, в том, до какого размера вырастают саламандры, люди и, вероятно, вообще все животные. Красота эксперимента Твити заключалась тем не менее в другом: он показал, что как бы ни были важны гормоны, не они ответственны за различия между крупными и мелкими саламандрами. Против ожидания, его саламандры оказались кривобокими. Как будто пересаженная конечность неким непостижимо таинственным образом попросту знала, какого размера должна достичь, вне зависимости оттого, к чему ее прикрепили. Это был эксперимент, показавший первичность локального над глобальным, ибо любая нога саламандры несла в себе предсказание собственной судьбы.[130] В награду за эти эксперименты Твити стяжал впоследствии не слишком громкую славу. Более непосредственным откликом стала его поездка в Берлин в 1931 году. Он отправился работать в Институт кайзера Вильгельма, в лабораторию Отто Мангольда, мужа Хильды Прешельдт, прославившейся открытием организатора. Там он встретился с выдающимися биологами своего времени: Гансом Шпеманом, Рихардом Гольдшмидтом и Виктором Хамбургером, которые вместе создали приоритет Германии в области биологии развития. Ни исследования Твити в Институте кайзера Вильгельма, ни его дальнейшая карьера в Стэнфорде, где он сделался одним из наиболее любимых студентами профессоров, не представляют для нас особого интереса, в отличие от времени и страны, в которой он тогда оказался. В 400 километрах к югу, в Мюнхене, другой молодой ученый со схожими научными интересами, но совершенно иными моральными устоями, только что поступил на медицинский факультет. Это был Йозеф Менгеле. Освенцим, 1944 Тот, чье имя навсегда повисло мрачной тенью над исследованиями по генетике человека, происходил из семьи состоятельных баварских промышленников. Красивый, вежливый и интеллигентный, он отказался от службы в семейной фирме и вместо этого занялся изучением медицины и философии в Мюнхенском университете. Он был честолюбив и горел желанием сделать себе имя, первым в семье прославившись на научном поприще. К середине 30-х годов он переехал во Франкфурт, где его покровителем стал Отмар Фрайгерр фон Вершуер, глава еще одного Института кайзера Вильгельма, в котором, однако, занимались в основном антропологическими исследованиями. Диссертация, написанная там Менгеле в 1935 году, отражала присущую немецкой антропологии страсть к расовым классификациям и содержала измерения сотен челюстных костей для выявления расовых различий. Две более поздние научные статьи касались наследования некоторых телесных нарушений, таких как волчья пасть. Все эти работы суховаты, основаны на фактах и, в общем, довольно скучны. В них нет и намека на будущую карьеру молодого ученого. Менгеле приехал в Освенцим 30 мая 1943 года. Он отправился туда по настоянию своего ментора, фон Вершуера. Именно он убедил ученика воспользоваться теми, как он выразился, "необыкновенными исследовательскими возможностями", которые перед ним откроются. Ко времени прибытия Менгеле в концентрационный лагерь в нем содержалось чуть больше 100 тысяч заключенных, и машина смерти работала на полную мощность. Менгеле был лишь одним из представителей многочисленного медицинского персонала в Аушвиц-Биркенау, к тому же не занимавшим высоких постов. Но после войны люди, пережившие лагерь, будут вспоминать именно его. Он запомнится им своей физической красотой, всегда идеальным состоянием военной формы, очаровательными манерами и улыбкой. Они запомнят его благодаря непостижимому свойству его личности: он мог мило поговорить с ребенком, а потом отправить того в газовую камеру. Они запомнят его, потому что он казался вездесущим, и еще потому, что нередко он был первым немецким офицером, которого они встречали. Когда заключенные выходили из телячьих вагонов на платформу в Биркенау, они слышали, как он кричит "налево" или "направо". "Налево" означало немедленную смерть, "направо" – что им сохраняют жизнь, по крайней мере на время.[131] Среди тех, кого оставили в живых, была тридцатилетняя еврейская женщина по имени Элизабет Овиц. Вместе с братьями и сестрами она прибыла в Аушвиц-Биркенау ночью 18 мая 1944 года. Их привезли в вагоне для перевозки скота вместе с 84 другими людьми. Слабые и растерянные после долгого пути, Овицы стояли на платформе Биркенау под ослепительным светом прожекторов. Элизабет спросила одного узника, еврея-инженера из Вены, где они находятся. Он ответил: "Это могила Израиля" – и показал на дымящиеся трубы, которые возвышались над лагерем. Через сорок три года она напишет: "Теперь мы поняли, что все, о чем знали раньше, но пытались вытравить из своего сознания, происходит на самом деле". Элизабет и остальных членов семьи – группу в двенадцать человек – отогнали к краю платформы. Именно тогда они впервые увидели Менгеле. Восхищенно осматривая их, он заявил: "Теперь у меня есть работа на двадцать лет вперед; теперь у науки есть интересный объект для размышлений". Овицы были трансильванскими евреями. Их отец, Шимшон Исаак Овиц, был ученым человеком и известным раввином, который мог творить чудеса. У него была разновидность карликовости под названием псевдоахондроплазия, особенность которой состоит в том, что тело больного остается почти неизменным, а конечности вырастают короткими и искривленными. Равви Овица почитали за его мудрость и сострадание. Многие румынские евреи верили, что Бог, лишив его нормального роста, взамен наградил необычными и редкостными качествами. Амулеты с кусочками пергамента, на которых клубились завитки древнееврейского письма, изящно выписанные его рукой на раши[132] как говорили, обладали целительной силой. У равви Овица было десять детей, семеро из которых, включая Элизабет, были карликами. Это совпадает с диагнозом псевдоахондроплазии, которая вызывается доминантно наследуемой мутацией. Псевдоахондроплазия. Элизабет Овиц (1914-1992) с братьями и сестрами. Бет-Галим, Израиль, ок. 1949 г. Иегуда Корен и Элиат Негев, Иерусалим. Когда Элизабет исполнилось девять лет, ее отец внезапно умер. Молодая вдова, женщина весьма находчивая, сочла, что малый рост ее детей может быть использован для их же пользы. Она дала им музыкальное образование, и впоследствии они смогли организовать труппу. Даже в то время, когда Румыния и Венгрия уже оказались втянутыми в политическую орбиту нацистской Германии, семейство Овиц со своим "Джаз-оркестром лилипутов" все еще колесило по провинциальным городкам расколотых и нестабильных государств Центральной Европы. В мае 1942 года Элизабет Овиц, которой тогда исполнилось двадцать восемь лет, встретила молодого театрального менеджера по имени Йошко Московиц. Он был высокий, красивый и без памяти влюбился в нее. Он написал сестре, что встретил женщину хотя и маленького роста, но с лихвой одаренную талантом, мудростью и трудолюбием. Они поженились в ноябре того же года, но всего через десять дней после свадьбы Йошко с нашитой желтой звездой Давида на рукаве пиджака был отправлен в трудовой батальон. Супруги встретились снова лишь по окончании войны. Скрывая свое еврейское происхождение, Овицы продолжали гастролировать еще в течение двух лет, но в марте 1944 года немецкие войска оккупировали Венгрию, и во время последних и самых страшных погромов, прокатившихся по стране, их все же схватили. В Освенциме Элизабет вместе с братьями и сестрами держали в отдельной комнате, чтобы они не теснились в блоке вместе с пятьюстами его обитателями. Им разрешали также носить собственную одежду и давали достаточно пищи, чтобы выжить. В течение какого-то времени они смогли оставаться вместе как отдельная семья, и им даже удалось убедить Менгеле, что они являются родственниками еще одного семейства из их деревни. Они платили за свое выживание тем, что исполняли заглавные роли в нелепой и безумной программе экспериментальных исследований Менгеле. Впоследствии Элизабет Овиц напишет: Самыми страшными экспериментами из всех [были] гинекологические. Через них проходили только те из нас, кто был замужем. Нас привязывали к столу, и начинались систематические пытки. Они вводили какие-то предметы в матку, выкачивали оттуда кровь, расковыривали внутренности, чем-то пронзали нас и брали кусочки образцов. Боль была непереносимой. Врач, проводивший эксперименты, жалел нас и просил вышестоящих прекратить опыты, так как они угрожают нашей жизни. Невозможно передать словами ту невыносимую боль, которую мы испытывали и которая не покидала нас много дней после того, как опыты были прекращены. Я не знаю, повлияло ли на Менгеле наше физическое состояние или гинекологические эксперименты были попросту завершены. В любом случае эти садистские опыты были приостановлены и начались другие. Они брали вытяжки спинномозговой жидкости и вливали нам в уши очень горячую или очень холодную воду, от чего у нас начиналась рвота. Впоследствии они вновь занялись экстракцией волос, и когда мы были уже на грани потери сознания, начинались болезненные опыты на мозге, а также в области носа, рта и кистей рук. Все стадии экспериментов четко документировались и иллюстрировались. Хочется заметить, что по иронии судьбы мы стали единственными в мире, чьи пытки были спланированы заранее и подтверждены "научными" отчетами для блага грядущих поколений... В этом, однако, Элизабет ошибалась. Менгеле подвергал пыткам множество других людей, в том числе немалое число близнецов, которых он в конечном итоге убивал и препарировал с единственной целью документально подтвердить сходство их внутренних органов. В течение семи месяцев Овицы балансировали между жизнью и смертью, оставаясь предметом одержимости Менгеле. Однажды, когда Менгеле неожиданно вошел в их отсек, самый младший в семье, Шимшон, которому едва исполнилось полтора года, неуверенно ковыляя, приблизился к нему. Менгеле взял ребенка на руки и мягко спросил, почему тот подошел к нему. "Он думает, что вы его отец". – "Я не его отец, – сказал Менгеле, – а всего лишь дядя". Тем не менее ребенок был крайне истощен от недоедания и постоянного забора крови. Менгеле демонстрировал Овицов высшим нацистским чинам. Он читал лекции о феномене карликовости, а в качестве иллюстрации выводил на сцену членов семьи Овиц, которые стояли там, обнаженные и дрожащие от холода и испуга. Эксперименты продолжались до октября 1944 года. И даже когда Третий рейх уже корчился в предсмертных муках, Менгеле не мог отказаться от своих маниакальных идей и пытался найти среди набора стеклянных глаз такие, которые по цвету подходили бы к карим глазам Элизабет. Как и во всех его поступках, причина этих действий остается загадкой. Освенцим был освобожден 27 января 1945 года. Для Элизабет и всех членов ее семьи приход советских войск означал отмену неизбежного смертного приговора. Почти все объекты опытов Менгеле подлежали уничтожению, как только эксперименты с ними заканчивались. В течение следующих четырех лет семейство странствовало по разрушенным городам Восточной и Центральной Европы. Реорганизовав труппу, Овицы исполняли мрачное танго, которое назвали танцем смерти[133]. Каждый вечер Элизабет в паре с одним из братьев танцевала партию Жизни, тогда как ее партнер изображал Смерть. В 1949 году семья эмигрировала в Израиль. Элизабет Овиц умерла в Хайфе в 1992 году.[134] Йозеф Менгеле так и не был предан суду за свои преступления и умер на бразильском пляже в 1979 году. Тормоза История семьи Овиц содержит в себе немало горькой иронии, но один из наиболее ярких ее примеров состоит в том, что Йозеф Менгеле был совершенно прав, когда считал этих людей удивительными. Лица с нарушениями наподобие псевдоахондроплазии действительно сообщают нам нечто важное о том, как кости вырастают до той длины, которая им положена, и каким будет наш рост. Менгеле не обнаружил, в чем причина карликовости, да его бессмысленные эксперименты никогда бы ему об этом и не рассказали. Но полстолетия спустя стало ясно, что обрубленные, искривленные и деформированные конечности, возникающие вследствие многих костных нарушений, говорят о явлении, открытом Виктором Твити: локальном контроле над ростом. Динамическая природа кости нигде не проявляется с такой очевидностью, как на концах длинных костей у ребенка. Каждый конец имеет область – ростовую пластинку, из которой осуществляется рост кости. В отличие от самой кости, заключенной в футляр из фосфата кальция, ростовые пластинки остаются мягкими и некальцифицированными. На рентгенограммах они выглядят как темные поперечные полоски, пересекающие белые концы каждой кости. Их можно наблюдать у ребенка на протяжении всего детства и отрочества: они постепенно уменьшаются в размерах и примерно к восемнадцати годам закрываются, знаменуя прекращение линейного роста. Каждая ростовая пластинка содержит сотни колонок хондроцитов, которые делятся и дифференцируются в четко согласованном порядке. Рождаясь на конце ростовой пластинки, наиболее удаленном от тела кости, они затем наполняются белком, из которого продуцируют вокруг себя хрящеобразный матрикс, после чего умирают. Остеобласты шагают по кладбищу хондроцитов, откладывают фосфат кальция и новые слои матрикса, вследствие чего кость с каждого конца растет все дальше и дальше. Псевдоахондроплазия, которой страдали Овицы, нарушает последовательность событий костеобразования. Мутация поражает ген, кодирующий один из белков, который входит в состав создаваемой хондроцитами хрящевой основы. Вместо того чтобы секретироваться клеткой, мутантный белок скапливается в хондроцитах, отравляя и убивая их задолго до положенного им срока. И хотя не все хондроциты погибают, воздействие этого нарушения столь велико, что рост резко замедляется. В результате возникают короткие, искривленные конечности, в то время как туловище и лицо практически не претерпевают никаких изменений.[135] Псевдоахондроплазия – лишь один из числа нескольких недугов, вызывающих появление очень коротких конечностей. Другим примером является собственно ахондроплазия – нарушение, с которым псевдоахондроплазию долго путали. От Птаха-Патайкоя, карликового божества юности, созидания и возрождения в Новом царстве Египта (1539-750 гг. до н.э.), до телевизионной рекламы газированных безалкогольных напитков, пожалуй, не найти другого такого часто встречающегося расстройства, которое столь широко использовалось бы в иконографии низкорослости.[136] Подобно одноименному недугу, ахондроплазия обусловлена недостатком хондроцитов, путешествующих по ростовой пластинке, но этот дефицит имеет совершенно иное происхождение. Ахондроплазия вызывается мутацией в рецепторе фибробластного фактора роста (FGF – fibroblast growth factors). FGF – это сигнальные молекулы, входящие в состав молекулярных часов, регулирующих рост конечности зародыша по продольной оси – от ближнего до дальнего ее конца. Однако после рождения FGF, вместо того чтобы способствовать росту конечности, тормозят его. Мы знаем об этом, потому что 99 процентов всех случаев ахондроплазии обусловлены мутацией, в результате которой одна аминокислота (глицин) в определенном локусе белковой последовательности FGFR3 (позиция 380) замещается другой (аргинином). Эта мутация обладает своеобразным свойством стимулировать повышенную активность молекулы FGFR3. Почти все мутации, которые описаны в этой книге, вызывают дефицит одного из белков, либо количественный, либо качественный, понижая степень его эффективности; нередко мутация служит причиной полного отсутствия белка. Если белок представляет собой сигнальную молекулу, как в случае с FGF, наблюдаемое нарушение будет следствием утраты некоего критического блока информации, который требуется клеткам. Мутация ахондроплазии, однако, отличается в том отношении, что заставляет рецептор передавать сигнал внутрь клетки даже при отсутствии связи с FGF. Вызываемый эффект подобен переключателю, который спонтанно включается, вместо того чтобы быть выключенным, и посылает часть нежелательной информации клеткам растущей конечности.[137] Если избыток сигнальных молекул FGF заставляет конечности необычно укорачиваться, значит, привычная роль FGF должна состоять в том, чтобы тормозить процесс роста конечности ребенка. Они выполняют эту функцию за счет ограничения скорости деления клеток в ростовой пластинке. Кости ребенка с ахондроплазией имеют ростовые пластинки, по размеру составляющие лишь малую толику того, какими они должны быть. По сравнению со здоровыми детьми в них содержится намного меньше делящихся хондроцитов и еще меньше тех, которые разрастаются и образуют хрящ.[138] Ахондроплазия – довольно-таки нестрашное нарушение. Однако избыток сигнальных FGF, в своей крайней форме, может вызывать ужасные последствия. В числе многих скелетов амстердамского Музея Фролика есть один, принадлежащий младенцу мужского пола, родившемуся мертвым где-то в начале 1800-х годов. При взгляде на скелет, ныне обозначенный номером М715, сразу становится ясно, что с ним что-то не так. Все до единого позвонки, ребра и тазовые кости ребенка усечены, искривлены или уплощены, а череп неимоверно увеличен. В своем грандиозном тератологическом трактате 1849 года Виллем Фролик описывает лоб ребенка как огромный шишковатый объект. Укороченные конечности и большая голова – оба эти симптома характерны для летальной скелетной дисплазии. Как явствует из самого названия, она приводит к смертельному исходу уже при рождении. Ахондроплазия. Мэри Эшберри (ум. 1856 г.) с черепом мертворожденного младенца. Линда Линдгрен, Лос-Анджелес, и Гретхен Уорден (Музей Мюттера, Филадельфия). Летальная скелетная дисплазия также вызывается активирующими мутациями гена FGFR3, но намного более разрушительного свойства, чем те, которые ответственны за ахондроплазию. Причиняемый ими вред показывает, что семейство FGF контролирует рост не только конечностей, но и некоторых других частей скелета, таких, например, как череп. Слегка напоминающие купол черепа многих карликов с ахондроплазией наводят на мысль о том, что их заболевание является ослабленной версией смертельного недуга. Если ребенок унаследует две копии ахондропластической мутации (имея, к примеру, двух родителей-ахондропластиков), то он умрет вскоре после рождения со всеми симптомами летальной скелетной дисплазии.[139] FGF – это, должно быть, лишь одна молекула в числе многих, ограничивающих рост той или иной части скелета. Каждый орган должен имеет механизмы, диктующие ему, когда нужно прекращать рост, причем многие из этих механизмов уникальны для конкретного органа. Едва ли существует хоть одна часть тела, которая бы не затормаживала или не ускоряла свой рост в результате того или иного генетического расстройства. Некоторые мутации заставляют детей рождаться с такими большими языками, что они не влезают в рот; в результате других – кишечник не помещается внутри брюшной полости.[140] Даже у мышц есть свои собственные механизмы регуляции роста. Бельгийские коровы специальной мясной породы замечательны тем, что имеют на треть больше мышц по сравнению с обычными коровами. Их бока напоминают ляжки олимпийских чемпионов-тяжелоатлетов. У них отсутствует белок, называемый миостатином (родственный, так уж случилось, молекулам BMP), который приказывает мышцам прекращать рост. У мышей, дефектных по миостатину, мышечная масса в два-три раза больше обычной, но цена этого избыточного роста оплачивается за счет его дефицита в других местах, поскольку внутренние органы у них вырастают меньше нормы. Наверняка существуют и люди с дефектами миостатина, но достоверные свидетельства о них отсутствуют. Возможно, экстра-мускулатура остается незамеченной, а если ее и замечают, то не считают причиной для беспокойства.[141] Обновление Ген, ответственный за axoндpоплазию, кодирует некоторую часть матрикса, который продуцируют вокруг себя хондроциты. Но это лишь малая его доля. Действительно, мыши, у которых этот белок полностью удален путем генетического инженеринга, вообще как будто не страдают от вредных последствий таких манипуляций. Можно вообще в первую очередь задаться вопросом, какова роль этого белка в матриксе. Далеко не так обстоят дела с остальным матриксом. Большая часть хряща состоит из коллагена. У людей насчитывается до пятнадцати различных типов коллагена, которые составляют около четверти всего количества белка в организме. Разновидности коллагена обнаруживаются в соединительной ткани и коже. Они соединяют вместе наши клетки. И именно они в значительной степени обеспечивают свойственные кости гибкость и силу. Мутации, повреждающие костные коллагены, вызывают нарушение, носящее название несовершенного остеогенеза (osteogenesis imperfecta). Существует по крайней мере четыре формы, объединяемые под этим диагнозом, причем некоторые из них заканчиваются летальным исходом в младенчестве. Наиболее характерный симптом этого генетического расстройства – чрезвычайная хрупкость костей у его жертв. По этой причине его также часто именуют болезнью стеклянных костей. Мутации оказывают свое разрушающее воздействие из-за иерархической природы, которой подчиняется структура коллагенов. Любой коллагеновый белок образован тремя пептидами – цепочками аминокислот, свернутыми вместе в тройную спираль. Тройные спирали, в свой черед, группируются вместе, образуя огромные фибриллы, или волокна, которые, сплетаясь вместе, определяют строение соединительной ткани или хряща. Каждый пептид кодируется отдельным геном, но один-единственный мутантный ген может разрушить любое число тройных спиралей и, следовательно, любое число фибрилл, а значит, и костей.[142] От несовершенного остеогенеза страдали французский художник Ашиль Амперер (1829-1898), портрет которого нарисовал Сезанн, и французский джазовый пианист Мишель Петруччиани (1962-1999). Эти артистические ассоциации придали болезни, по крайней мере во Франции, псевдоромантический ореол (на ум приходит "человек со стеклянными костями" из фильма Жан-Пьера Жене "Амели"). Реальность куда более прозаична. Дети с несовершенным остеогенезом часто страдают небольшими костными переломами, о которых родители вообще не подозревают. Когда же, после более серьезного перелома, дети наконец попадают в больницу, рентгеновское обследование выявляет большое количество ранее поломанных и заживших костей. На этой почве часто возникают подозрения, что родители жестоко обращаются с детьми. В Соединенных Штатах больные дети попадали под опеку сверхретивых социальных работников, а некоторые родители подчас отправлялись за решетку. Несовершенный остеогенез II типа. Мертворожденный младенец, Амстердам. Ян-Рулоф Остра (Музей Фролика, Амстердам). Даже после того как ростовые пластинки закрываются и прекращается рост, скелет не знает покоя. Внутреннее содержимое большинства костей у взрослого человека полностью замещается каждые три или четыре года, в то время как наружные, более твердые части подлежат замене примерно раз в десятилетие. Этот процесс разрушения и обновления осуществляется на основе союза между остеобластами и другими клетками, которые постоянно поглощают скелет, откусывая маленькие кусочки от его основы и высвобождая тем самым необходимые составные части, наподобие множества резцов. Это остеокласты – гигантские клетки, которые прикрепляются к костным фрагментам и растворяют их с помощью поедающих белок ферментов и соляной кислоты. Кости строятся с помощью остеобластов, но свои окончательные формы они принимают при участии остеокластов, так как именно эти клетки высекают протоки, каналы и полости для прохождения нервов и кровеносных сосудов и размещения костного мозга.[143] Существует немало способов, чтобы сдвинуть равновесие между ростом и разрушением, которое характерно для каждой кости. Избыток костного вещества может быть следствием избытка остеобластов или нехватки остеокластов. Остеопетроз, в буквальном переводе – каменные кости[144], – заболевание, связанное с остеокластами.[145] Оно противоположно намного более известному остеопорозу, которое становится настоящим бичом для женщин постклимактерического возраста.[146] Состояние, при котором кости делаются как камни, может быть летальным. Существует особенно тяжелый вариант этого расстройства, поражающего детей и убивающего их до достижения двадцатилетнего возраста. Они часто умирают от инфекционных заболеваний, так как кость аккумулируется в полости, служащей для производства костного мозга, который является одним из основных источников клеток иммунной системы. Кажется парадоксом, что кости людей, больных остеопетрозом, также имеют склонность довольно легко ломаться. Это, вероятно, происходит вследствие нарушения архитектоники кости. И когда переломы случаются, их заживление происходит нелегко, так как остеокласты, в числе прочих своих функций, выравнивают зазубренные края костей, если уж мы их поломали. По мнению некоторых, остеопетроз, хотя и в довольно мягкой форме, был причиной маленького роста Анри де Тулуз-Лотрека. Это лишь один из нескольких диагнозов, которые задним числом пытаются поставить французскому художнику. Среди других – ахондроплазия и несовершенный остеогенез. Ни один из этих диагнозов не является достаточно убедительным. Существует такое огромное количество костных нарушений, а симптомы их столь разнообразны и трудноотличимы, что их легко перепутать, тем более если все, что мы знаем о пациенте, – это сведения из его биографии, пачка фотографий и серия автопортретов, по большей части карикатурных. И все же поиски "болезни Лотрека" продолжаются. Притягательность этого занятия, по крайней мере для французских врачей, отчасти объясняется тем, что художник был потомком одного из самых знатных семейств Франции – графского дома Тулуз-Лотреков, династии непокорных аристократов Юга, которые в то или другое время правили большей частью Руерга, Прованса и Лангедока, грабили Иерусалим, не чурались ереси, бывали отлучены папой от церкви (в десяти отдельных случаях) и в XIII веке испытали на себе ярость и военную мощь французской короны. Но сверх всего этого за стремлением найти причину болезни Анри Тулуз-Лотрека стоит убеждение, что этот одаренный художник сделал собственное уродство частью своего искусства. В этом, возможно, что-то есть. Пройдитесь по залам Музея д'Орсэ в Париже или музея в Альби, неподалеку от самой Тулузы, полностью посвященного его работам, и вас поразят ноздри на его полотнах. Просматривая картину за картиной – портреты танцовщицы Гулю, актрисы Иветт Гильбер, светской львицы Мей Мильтон или многих других, неизвестных представительниц парижского полусвета, которые населяют живопись Лотрека, вы в первую очередь видите ноздри – их зияющие, темные провалы. Этот ракурс едва ли можно назвать лестным для его моделей, но, возможно, именно такими видел их художник, поскольку был довольно невысоким. К моменту окончания роста длина его тела составляла менее 150 сантиметров. Критики также утверждают, что болезнь Лотрека оказала и другое, более незаметное воздействие на его искусство: после 1893 года в нем обнаруживается четкая тенденция удалять у моделей ноги, так чтобы в раме оставались только головы и торсы. Этот прием позволял исключить ту часть анатомии, о которой он сам предпочел бы забыть. Пикнодизостоз (предполагаемый). Анри Тулуз-Лотрек (1864-1901). (Музей Тулуз-Лотрека, Альби, Тарн, Франция) Ноги Лотрека причиняли ему много страданий. У него было как будто вполне счастливое детство, но когда ему исполнилось семь, мать повезла его в Лурд, где надеялась найти исцеление от каких-то проблем с ногами, довольно смутно описанных. Он был скован, неуклюж и часто падал. В школу он проходил всего один год, после чего его забрали домой, так как потасовки на школьном дворе были явно не для него. К десяти годам он начал жаловаться на постоянные сильные боли в ногах и бедрах; в тринадцать лет незначительное падение привело к переломам обеих бедренных костей, которые, если судить по тому промежутку времени, когда ему пришлось передвигаться, опираясь на две трости, срослись только через полгода. Он будет пользоваться тростью на протяжении практически всей своей взрослой жизни, и его друзья, безусловно, верили, что он преодолевает любое расстояние с неохотой и с большим трудом. По мере роста необычные изменения произошли и в его внешности. Он был хорошеньким малышом, затем красивым мальчиком, но впоследствии у него отвисла нижняя губа, стала течь слюна, речь сделалась непонятной и отрывистой, появилась шепелявость, а зубы сгнили еще в отрочестве. Все это отличало его от родителей, которые были очень хороши собой. Он стеснялся своего вида, всю жизнь носил бороду и никогда не улыбался перед камерой. Многие критики утверждают, что именно своеобразная ненависть к собственному телу заставляла его искать и изображать то, что было наиболее некрасивым и неприятным в его milieu[147]. Но Париж fin-de-siecle[148] вполне мог быть некрасивым и неприятным местом. Однажды ночью у "Максима", где Лотрек делал молниеносные карикатурные зарисовки своих соседей, один из них обратился к нему, заметив, что тот захромал прочь. "Месье, вы забыли свою трость," – сказал он, указывая на огрызок карандаша, оставленный на столе. В другой раз Иветт Гильбер, разглядывая один из своих многочисленных написанных им портретов, заявила: "Действительно, Лотрек, – ты гений безобразного". Он ответил: "Да, так оно и есть". Лотрек, как считают, страдал разновидностью остеопетроза, так называемым пикнодизостозом, который вызывается дефицитом фермента, используемого остеокластами для растворения белкового матрикса кости. В зрелом возрасте активность этого фермента частично подавляется гормонами. Именно снижение концентрации эстрогена у женщин постклимактерического возраста, а следовательно, ненужная активность фермента являются причиной остеопороза. Диагноз пикнодизостоза был поставлен Лотреку в 1962 году двумя французскими врачами Пьером Марото и Морисом Лами, но их мнение не осталось неоспоренным. Джулия Фрей, автор последней биографии Лотрека, признает, что по крайней мере часть симптомов согласуется с этим диагнозом, но в то же время отмечает, что многие признаки для него совсем нехарактерны. У больных пикнодизостозом, как правило, мягкие головы, наподобие голов "бескостных" капских малайцев; в отношении Лотрека таких свидетельств нет, его голова была вполне крепкой. Каково бы ни было заболевание Лотрека, по-видимому, он разделял его с другими членами семьи. К 1864 году, когда родился Анри Мари Раймон граф де Тулуз-Лотрек Монфа, его семья, по-прежнему богатая, характеризовалась высокой степенью близкородственного скрещивания (инбредностью). Наполеоновская отмена права первородства подталкивала и без того резко сократившуюся французскую аристократию сохранять то богатство, которое еще оставалось в семьях, с помощью простого приема – заключения браков только в пределах дома. Родители Анри были двоюродными братом и сестрой, равно как и его дядя с тетей. Все вместе они произвели на свет шестнадцать детей, четверо из которых, включая Анри, были карликами, причем трое других значительно больше отставали в росте, чем он. На самом деле, весьма вероятно, что по меньшей мере некоторые из ныне живущих членов этого благородного клана все еще являются носителями мутации, хотя действие ее, скорее всего, не проявляется по той причине, что практика кровосмесительных браков прекращена. У самого Лотрека не было сомнений по поводу истинной причины его заболевания. Как-то ночью, когда он находился в одном из своих любимых прибежищ – Ирландском и Американском баре на Монмартре, две женщины заспорили по поводу несчастной собаки, чьи ноги тряслись от дисплазии бедренных суставов. Владелица собаки соглашалась, что та не отличается красотой, но тем не менее настаивала на ее чистопородности. "Ты что, шутишь, – у этой собаки и родословная? Да ты погляди на ее гадкий мех и искривленные ноги, – смеялась подружка. – На нее просто жалко смотреть". – "Ты явно в этом ничего не понимаешь, – ответила хозяйка собаки и повернулась к Анри, который сидел рядом с ней. – Скажите же ей, месье, что моя собака вполне может быть уродливой, но с хорошей родословной". Анри слез с высокого стула у стойки бара и, выпрямившись на все 150 сантиметров своего роста, взмахнул перепачканной углем рукой в знак приветствия, пробурчав: "Это вы у меня спрашиваете?"[149] Глава VI Война с журавлями [о росте] Пигмей, изображенный с ахондроплазией. Аттический краснофигурный ритон, ок. 480 г. до н.э. (Эрмитаж, Санкт-Петербург). Они недоброжелательно глядят на нас со стен Прадо, Лувра и Национальной галереи. Запечатленные Веласкесом, Ардженти, Бронзино, Ван Дейком и дюжиной других ныне забытых художников, придворные карлики стоят, облаченные в богатые, изысканные одежды, с миниатюрными кинжальчиками, висящими сбоку на поясе, в окружении разных предметов, олицетворяющих мир роскоши и могущества. На одной картине рядом с карликом стоит юный принц, и этот контраст как нельзя лучше оттеняет благородную элегантность мальчика. На другом полотне карлика поместили рядом с холеной породистой охотничьей собакой. Плечи мужчины находятся на уровне загривка пса.[150] «К концу XVII столетия, – писал Изидор Жоффруа Сент-Илер, – считалось необходимым выискивать развлечения особого рода для забавы князей и королей, и эта печальная привилегия служить игрушками сильных мира сего была уготована карликам». Но придворные карлики появились гораздо раньше. Моду на них установила Екатерина Медичи (1519-1589). Рассчитывая вывести породу миниатюрных людей, она организовала брак между двумя карликами. Через несколько лет то же самое попыталась сделать супруга бранденбургского курфюрста. Однако в обоих случаях супружеские пары оказались бесплодными. Петр I довел забаву до крайности. В 1701 году он поставил грандиозный спектакль, организовав свадьбу двух карликов, на которую были приглашены не только его придворные, но и послы всех иностранных держав, аккредитованные в столице. Царь отдал также приказ собрать на свадьбу всех карликов, живущих в радиусе 200 миль. Около дюжины маленьких мужчин и женщин въехали в столицу под улюлюканье толпы, сидя на спине единственной лошади. При дворе некоторые из карликов, понимая, что будут выставлены на посмешище, отказались принимать участие в потехе. Тогда Петр заставил их прислуживать другим. Были ли все придворные карлики несчастными, униженными созданиями, полностью лишенными человеческого достоинства? Жоффруа, написавший эти строки в 1832 году, считал, что да. Так же думал и Бюффон на полстолетия раньше.[151] Однако Йозеф Борувлаский с ними бы не согласился. Для него малый рост был подарком судьбы, счастливым стечением обстоятельств. Благодаря ему Борувлаский вырвался из безвестности. Вот как он описывает свою историю в «Мемуарах»: Я родился в окрестностях Шальеза, столицы Покуции, в Польской России в ноябре 1739 года. Мои родители были среднего роста. У них родилось шестеро детей: пятеро сыновей и одна дочь. По одному из капризов природы, который невозможно объяснить, да и вряд ли найдешь другой такой случай в анналах истории человеческого рода, трое из этих детей выросли выше среднего роста, а двое, в том числе и я, достигли роста, который обычно свойствен детям четырех-пяти лет. Борувлаские были бедными. Йозефу едва исполнилось девять лет, когда умер его отец, оставив семью в нищете. Однако сельская Польша XVIII столетия была глубоко феодальным обществом, где все решалось с помощью покровителей, и у матери Йозефа была поддержка в лице молодой местной аристократки Стаорины де Каорлиц. Очарованная маленьким Йозефом, она убедила его мать оставить мальчика жить у нее, дабы он мог получить хорошее воспитание. Борувлаский расцвел в своем новом доме. К подростковому возрасту он вырос всего до 61 сантиметра, но приобрел манеры, которых не устыдились бы самые благородные польские юноши. Положение немного осложнилось, когда Стаорина вышла замуж и родила ребенка, но Борувласкому и здесь повезло. Ему стала протежировать другая, еще более богатая аристократка – графиня де Хумиецка. Это стало его победой. Графиня была не из тех, кто собирался прозябать в глуши провинциальной Польши. Ее неодолимо тянуло к путешествиям и хорошему обществу. Посадив Йозефа в карету, она отправилась покорять дворы европейских монархов. Вена 1754 года. «Какая вещь, – спросила Мария Терезия, – в этой комнате самая удивительная?» Борувлаский окинул взглядом великолепное рококо Шёнбрунна, но ответ у него уже был готов. «Самая удивительная вещь в этой комнате – маленький человечек, сидящий на коленях у великой женщины». Ее императорское величество, властительница всей Австрии и Венгрии, была в восторге. В Мюнхене князь Кауниц предложил Борувласкому пожизненную пенсию. В Луневиле изгнанный из страны король поляков Станислав заявлял, что он наслаждается его рассказами – настолько они интереснее того, на что способен его собственный придворный карлик, несчастный юноша по имени Бебе. Был там и граф де Треффан, который делал записи для своей статьи о карликовости, готовя ее в энциклопедию. В Париже Борувлаский считался гостем герцога Орлеанского, в Гааге имел аудиенцию у статхаудера. В Версале юная Мария Антуанетта подарила ему, сняв с собственного пальца, бриллиантовое кольцо. Гипофизарная карликовость. Йозеф Борувлаский (1739–1837) Неизвестный художник. (Национальный музей, Краков). Так пролетели десять блистательных лет. А дальше Борувлаский влюбился. Предметом его ухаживаний была актриса, которая с презрением отвергла его. Годы спустя он напишет: «Если я и могу упрекнуть природу в том, что она отказалась дать мне такое же тело, как у других мужчин, то она с лихвой компенсировала это, наградив меня чувствами, каковые, правда, проявились довольно поздно, но, при свойственной моему характеру теплоте, дали мне ощутить такое счастье, воспоминания о котором наполняют мое сердце радостью и вечной благодарностью». К тому времени он уже мог спокойно размышлять о своей юношеской страсти, так как задолго до написания этих строк завоевал сердце другой темноглазой молодой аристократки по имени Изалина Борбутен. Она тоже поначалу смеялась над ним, играла с ним и относилась к нему как к ребенку. Но он упорствовал и без конца посылал ей полные страсти письма. Он обратился к королю Польши с просьбой о пенсии, которая позволила бы содержать ее. Пенсию ему дали, так же, как и титул. Она сдалась. Борувлаский был плодом французского Просвещения. В его «Мемуарах» слышится гуманный, рациональный и вопрошающий голос энциклопедистов: Было нетрудно судить о том, что мне уготован исключительно малый рост с самого момента моего рождения, так как в то время он равнялся всего восьми дюймам. И все же, несмотря на столь небольшой размер, я не был слабеньким или хилым; напротив, моя мать, которая кормила меня грудью, часто утверждала, что ни один из ее детей не доставлял ей меньше хлопот. Я начал ходить и говорить в том же возрасте, что и другие дети, а мой рост изменялся следующим образом: В один год я был 11 дюймов высотой В три года 1 фут 2 дюйма В шесть лет 1 фут 5 дюймов В десять 1 фут 9 дюймов В пятнадцать 2 фута 1 дюйм В двадцать 2 фута 4 дюйма В двадцать пять 2 фута 11 дюймов В тридцать 3 фута 3 дюйма На этом рост мой остановился, и впоследствии я не прибавил ни одной восьмой дюйма. Мой брат, так же как и я, рос до тридцати лет, а потом перестал. Я специально привожу это двойное доказательство, чтобы устранить мнение некоторых натуралистов, утверждающих, будто карлики растут всю жизнь. Это поразительно и довольно-таки странно. У большинства людей рост прекращается между семнадцатью и двадцатью годами. Но Борувлаский, хотя и был низкорослым, продолжал расти и на третьем десятке жизни. Ему понадобилось также немало времени, чтобы открыть для себя тайны женского очарования: «В двадцать пять я был таким же, как любой пятнадцатилетний парнишка». Очевидно, что он отличался поздним созреванием. Йозеф Борувлаский умер во сне 5 декабря 1837 года в тихом английском городке со знаменитым кафедральным собором – Дареме. Он прожил счастливую и во всех смыслах богатую жизнь. Рожденный в безвестности, он достиг ошеломляющих социальных высот. Известный своим умением вести беседу и скрипичным мастерством, он был знаком с большинством коронованных особ Европы. Получив дворянский титул от короля Польши, он также находился под покровительством принца Уэльского. Он называл своими друзьями герцога и герцогиню Девонширских. Он был украшением Дарема; городской совет платил ему только за то, чтобы он жил там. Он женился на благородной красавице, воспитал детей и умер в почтенном возрасте девяноста восьми лет, пережив практически всех своих современников. Таким был достойный конец выдающейся жизни. Ибо Йозеф, граф Борувлаский, был не просто одним из европейских аристократов, изгнанных со своей родины. Он был последним придворным карликом.[152] Совершенство пропорций Почему Борувлаский был таким маленьким? Задержка полового созревания указывает на возможное объяснение, равно как и несколько портретов, выполненных маслом, с полдюжины гравюр и бронзовая статуя в полный рост, которая и по сей день стоит в фойе мэрии Дарема. Все эти изображения свидетельствуют, что граф, несмотря на свой малый рост, был превосходно сложен. Правда, его пропорции были не совсем такие, как у взрослого мужчины, а скорее соответствовали пропорциям ребенка того же роста. Но никаких следов костных нарушений, вроде ахондроплазии или пикнодизостоза, которые заставляют конечности расти короткими и изогнутыми, у Борувлаского отмечено не было. Этот вид низкорослости говорит о сбое в одном из наиболее мощных и глубоко проникающих молекулярных механизмов, которые определяют, какого размера нам предстоит достичь. У основания нашего мозга в углублении черепа лежит железа под названием гипофиз. Величиной с горошину, она характеризуется необычайным могуществом. Гипофиз секретирует шесть гормонов, которые совместными усилиями регулируют развитие молочных желез у подрастающих девочек и секрецию молока у матерей; выработку спермы у мужчин и созревание яйцеклеток у женщин; наши аллергические реакции и то, как мы справляемся со стрессом. Но большая часть гипофиза предназначена для производства гормона роста: одной этой молекулы вырабатывается в тысячу раз больше, чем всех пяти остальных гормонов. Секретируемый в кровяное русло, гормон роста циркулирует по всему телу. Он отдает клеткам организма простой приказ: «Растите и делитесь». Гормон роста, конечно, не единственная молекула, которая может это делать. В каждом органе имеются собственные молекулярные механизмы для регуляции его размеров и формы, но способность гормона роста распространяться по всему телу из единого источника означает, что он одновременно контролирует рост всех тканей, умножает нашу плоть и кости.[153] У Йозефа Борувлаского имелись все признаки недостатка гормона роста: тело с размерами и пропорциями четырехлетнего ребенка, запоздалое половое развитие и живой зрелый ум. Невозможно точно идентифицировать причину молекулярного сбоя. Мутация в любом из полудюжины генов, контролирующих регуляцию гормона роста, может быть ответственна за низкорослость Борувлаского. Не исключено и другое: гормона роста у него было достаточно, но отсутствовали связывающие его рецепторы.[154] В предгорьях эквадорских Анд существует целое сообщество, около пятидесяти человек, с мутацией рецепторов. По окончании роста мужчины достигают в высоту всего 124 сантиметров. Они живут в двух деревнях и характеризуются довольно тесным скрещиванием. Хотя они католики, многие носят еврейские имена. Полагают, что они потомки conversos[155], которые переехали в Новый Свет, спасаясь от преследований инквизиции. Возможно, что они привезли с собой карликовую мутацию, так как абсолютно такая же мутация была обнаружена у одного марокканского еврея. Эквадорские карлики очень способные; в школе они специализируются на том, что выигрывают призы на разных конкурсах. Однако, становясь старше, они устают от насмешек своих сверстников и бросают учебу, а в самом последнем поколении ни один из взрослых членов сообщества не вступил в брак. В 1782 году Йозеф Борувлаский встретил свою физическую противоположность. Вскоре после моего прибытия в Лондон там появился настоящий гигант. Он был восьми футов четырех дюймов росту, хорошо сложен, имел приятную наружность и, что необычно для столь высоких людей, обладал физической силой, соответствующей его размерам. Ему было тогда двадцать два года; множество людей хотело увидеть нас рядом, в особенности герцог и герцогиня Девонширские, мои достойные покровители, которые вместе с леди Спенсер предложили мне встретиться с гигантом. Я отправился с ними и думаю, что оба мы были одинаково потрясены. Гигант на некоторое время потерял дар речи. Потом он очень низко наклонился и протянул мне руку, в которую, я уверен, поместилась бы дюжина моих. Он сделал мне учтивый комплимент и приблизил меня к себе, чтобы зрителей могли еще больше поразить различия в наших размерах: моя макушка едва доходила ему до колена. Борувлаский не называет нам имени этого человека, но на гравюрах того времени изображена встреча элегантно одетого карлика и человека по фамилии О’Брайен, который в рекламных целях называл себя Ирландский Гигант. Это едва ли проясняет дело, так как в Лондоне георгианской эпохи обитало по крайней мере четыре Ирландских гиганта, двое из которых представлялись под фамилией О’Брайен. Оба родились в Ирландии около 1760 года; оба утверждали, что приходятся прямыми потомками Брайену Бору, ирландскому правителю, который, согласно легендам, был грандиозных размеров. Оба приехали в Лондон в начале 1780-х годов. Один демонстрировал себя на Пикадилли, другой – в парке Сент-Джеймс. Оба заявляли, что их рост превосходит 8 футов, но на деле ни тот, ни другой не был выше 235 сантиметров. Мы знаем об этом, потому что их скелеты были измерены. Один из этих мужчин, Патрик Коттер, похоронен в Бристоле. Гроб с его останками был обнаружен в 1906 году, и до перезахоронения скелет подвергли тщательному обследованию. Скелет другого гиганта, Чарльза Берна, демонстрируется в Хантеровском музее Королевского колледжа хирургов и врачей в Линкольн-Инн-Филдз, в Лондоне. Он известен там под прозвищем Чарли и являет собой внушительное зрелище благодаря массивным, будто вырезанным из дуба, костям. Отчасти это следствие их коричневатого оттенка, который вызван, как говорят, поспешностью и секретностью изготовления препарата. Челюсти, подбородок и посторбитальные гребни настолько мощны, что, должно быть, при жизни придавали лицу устрашающее выражение. Ко времени кончины, которая, вероятно, была следствием алкоголизма, у гиганта развился смертельный страх, что его кости станут добычей анатомов. И страх оказался ненапрасным, так как в одной газетной публикации того времени описывается, как «целая толпа хирургов предъявила права на останки бедного почившего ирландца, окружив его дом, как гарпунеры окружают тушу огромного кита». В итоге труп достался анатому и хирургу Джону Хантеру, который выварил его и поместил скелет туда, где его можно видеть и сегодня.[156] У Чарльза Берна была опухоль гипофиза. В 1911 году сэр Артур Кит, куратор Хантеровского музея, вскрыл череп Чарли. Углубление, в котором некогда находился гипофиз, было кавернозным; сама железа, должно быть, по размеру больше походила на маленький помидор, чем на горошину.[157] Опухоли гипофиза секретируют большое количество гормона роста, который заставляет клетки ростовых пластинок в конечностях ребенка делиться с аномальной быстротой, что, в свою очередь, приводит к сверхинтенсивному росту. Опухоли гипофиза у детей и сейчас встречаются столь же часто, как и в те времена, когда ирландские гиганты дефилировали по лондонскому Вест-Энду, но в наши дни их своевременно распознают и удаляют хирургическим путем. В мае 1941 года Хантеровский музей пострадал от прямого попадания немецких зажигательных бомб: были уничтожены гигантский ископаемый броненосец, чучела крокодилов и многие из ценнейших анатомических препаратов, сбору которых Хантер посвятил свою жизнь. Чарли, однако, уцелел, если можно так выразиться. Гипофизарный гигантизм. Чарльз Берн (1761–1783) (Музей Хантера). Воспроизводится с любезного разрешения Королевского колледжа хирургов Англии. Пигмеи На старой фотографии можно увидеть три скелета, которые в былые дни стояли в публичных галереях Музея естественной истории в Лондоне. Центральный скелет некогда принадлежал мужчине-европейцу. Слева от него сгорбленный скелет береговой гориллы; справа – грациозно выпрямленный скелет женщины-пигмейки. Скелеты пигмейки ака, мужчины-европеоида и гориллы. Скелет пигмейки привезен Эмин-Пашой из Конго в 1883 г. (Библиотека Уэллком, Лондон). Едва различимая надпись на этикетке объясняет, что пигмейский скелет был привезен Эмин-Пашой, исследователем Африки и чиновником Оттоманской империи. В дневнике, где он описывает свою экспедицию 1883 года, сказано, что скелет оказался очень дорогим, так как из-за вспышки каннибализма в земле Монбуту резко возросли цены на человеческие останки. И все же он без звука заплатил запрашиваемую цену.[158] Скелеты пигмеев пользовались большим спросом, и каждый европейский музей мечтал о приобретении такого экспоната. Прошло всего тринадцать лет с тех пор, как африканские пигмеи перестали быть мифическими существами и сделались частью современного мира. Минуло несколько дней, и вдруг утром внимание мое привлек какой-то шум в лагере. Я узнал, что Мухаммед неожиданно захватил одного из пигмеев, бывших в услужении у короля, и теперь тащит его ко мне, невзирая на отчаянное сопротивление, прямиком в мою палатку. Я выглянул наружу и действительно увидел странное маленькое существо, сидящее на правом плече Мухаммеда, нервно теребящее голову и бросающее во все стороны тревожные взгляды. Мухаммед вскоре водрузил его на почетное место. Рядом с ним поместили королевского переводчика. Таким образом наконец-то смог я истинно порадовать свой взор лицезрением живого воплощения мифов тысячелетней давности. Автор этих строк по имени Георг Август Швайнфурт был ботаником и путешественником, родившимся в Риге; имя пигмея – Акадиму.[159] Они встретились в 1870 году на берегах реки Уэле, там, где сейчас находится самая северная провинция Республики Конго. Акадиму не должен был существовать. К тому времени, когда Швайнфурт случайно столкнулся с ним, представление о том, что где-то в темном сердце Африки существует раса маленьких людей, давно было отнесено к разряду фантазий греческих мифотворцев. «Троянцы наполнили воздух криками, наподобие журавлей, которые улетают с началом зимы и внезапных дождей и устремляются к Океанскому проливу с пронзительными криками, неся скорую гибель пигмеям», – писал Гомер. Более поздние авторы сообщали о королеве пигмеев по имени Герана, которая за свою красоту и тщеславие была превращена в журавля завистливой богиней и стала врагом собственного народа. Война пигмеев с журавлями, или, как называли ее греки, гераномахия, – это занимательная легенда, насчитывающая несколько тысячелетий. Плиний повторил этот сюжет, украсив его новыми подробностями: он поселил пигмеев во Фракии, Малой Азии, Индии, Эфиопии и у истоков Нила, а также не смог удержаться от таких уточнений, согласно которым они едут сражаться, оседлав козлов, и достигают в росте всего 73 сантиметров. Озадаченные средневековые схоласты размышляли, могут ли столь маленькие существа вообще быть людьми, и пришли к заключению, что не могут.[160] Уже совсем недавно, в 1716 году, Джозеф Аддисон написал двадцать три строфы на латыни, под общим названием «Битва пигмеев и журавлей».[161] Кроме того, он опубликовал на латинском языке еще два стихотворения, восхваляющие барометр и мяч для игры в кегли. В своем эссе об Аддисоне д-р Джонсон[162] иронически замечает, что на некоторые темы по-английски лучше вовсе не писать. Стихотворение Аддисона было последней вершиной гомеровской традиции. В конце XVII века упрямые головы из Королевского общества протестировали легенду с помощью эмпирических доказательств и сочли их неубедительными. В 1699 году анатом Эдвард Тайсон написал памфлет, в котором утверждал, что вскрытый им труп, якобы принадлежавший пигмею, на самом деле не был человеческим.[163] В этом, как выяснилось, он был абсолютно прав, поскольку его пигмей оказался шимпанзе. В дальнейшем Тайсон написал разгромный комментарий, где разъяснял, что, поскольку заселенный человеком мир уже хорошо известен, расы маленьких людей не существует. Рассказы древних греков о пигмеях, как и о циноцефалах (людях с песьими головами) или сатирах, базировались на искаженных представлениях об африканских человекообразных обезьянах. Доводы Тайсона были ясны, и намерения его заслуживали одобрения, но он явно переоценил степень тогдашних сведений о мире. Он также не сумел понять, что выразительные сравнения Гомера могли быть следствием каких-то конкретных, но трансформированных знаний. Гомеру наверняка было известно, что аисты, которых и по сей день можно увидеть в греческих деревнях сидящими на гнездах поздним летом, зимуют каждый год в Африке. Вывод, что там должны жить и пигмеи, напрашивался сам собой. Кроме того, он, вероятно, также помнил какие-то смутные предания, полученные от египтян. Почти за тысячу лет до жизни Гомера Пепи II, фараон VI династии, писал одному из своих военачальников с настоятельной просьбой позаботиться о пигмее, найденном во время похода в Южные леса. Акадиму, первый пигмей нашего времени, принадлежал к племени людей, которые именовали себя ака – под этим названием они известны и до сих пор.[164] Ака – только одно из сообществ в довольно гетерогенной семье низкорослых людей, живущих в африканских лесах между 4° северной и южной широты. Если дать определение пигмею как любому члену группы со средним ростом взрослого мужчины менее 150 сантиметров, то в Африке найдется около ста тысяч таких людей. Самыми низенькими будут эфе из лесов Итури: их мужчины вырастают только до 142 сантиметров, а женщины – до 135 сантиметров. Они считаются коренными обитателями этих мест, жившими там до прихода с севера-запада около 2 тысяч лет назад более высокорослых банту. Французский антрополог Арман де Катрфаж полагал, что африканские пигмеи представляют собой остатки племени невысоких, темных, курчавоволосых людей со стеатопигией[165], которое некогда занимало большую часть территории земного шара. Это не такая уж нелепая идея. На островах Индийского океана и Южно-Китайского моря существуют группы людей, физически почти неотличимых от африканских пигмеев. Это негритосы, смутные образы которых появились в антропологии с тех пор, как испанцы впервые столкнулись с ними при заселении внутренней части острова Лусон в Филиппинском архипелаге. Новейшие генетические исследования свидетельствуют о древности негритосов: они были первым палеолитическим населением Азии. Подобно всему остальному человечеству, они пришли из Африки, однако по сравнению с другими группами они не являются более тесными родственниками африканцев, а тем более африканских пигмеев. Их низкорослость могла развиться совершенно независимо.[166][167] Негритосы. Порт-Блэр, Андаманские острова, 1869-1880 гг. Е.Х. Манн (Королевский антропологический институт Великобритании и Ирландии). Теории относительно причин небольшого роста пигмеев возникли задолго до того, как были получены достоверные знания об их существовании. Гераномахия была излюбленным сюжетом в произведениях аттических художников, которые знали о пигмеях только две вещи: что они маленькие и не любят журавлей. Поэтому на краснофигурном ритоне классического периода изображен карлик с ахондроплазией, бьющий птицу дубинкой.[168] Диагноз ахондроплазии можно считать бесспорным: конечности птичьего противника короткие и искривленные, в то время как его торс, голова и гениталии сохраняют нормальные размеры. В Помпеях обнаружена фреска, которая теперь находится в Археологическом музее Неаполя. На ней одни пигмеи охотятся на крокодилов, в то время как других поедают бегемоты, а третьи энергично совокупляются на берегах Нила. Эти римские пигмеи не имеют заметных нарушений; пожалуй только, у них крупноватые головы и тоненькие конечности, как у истощенных трех-четырехлетних детей. Странности этих изображений вполне извинительны, так как никто из художников никогда не видел ни одного пигмея. Они изображали сказочные сюжеты, используя нечто знакомое. Еще удивительнее, что совсем уже недавно, в 1960 году, ведущий антрополог и знаток пигмеев утверждал, что их малый рост объясняется ахондропластической мутацией. И хотя нам немного известно о том, чем вызвана низкорослость пигмеев, это утверждение, конечно, неверно.[169] То, что пропорции тела пигмеев не являются результатом какой-либо известной патологии, ясно демонстрирует скелет, привезенный Эмин-Пашой. Он свидетельствует, что конечности пигмеев характеризуются прекрасными пропорциями, которые тем не менее отличны от таковых более высокорослых людей. Действие естественного отбора в течение десятков тысячелетий создало форму, более изысканно вылепленную, чем этого можно было бы достичь посредством внезапных мутаций, известных клиническим генетикам. Обследования детей, родившихся в результате браков между высокорослыми африканскими фермерами и женщинами-пигмеями, говорят о том, что малая величина пигмеев, вероятно, не есть следствие одной-единственной мутации, так как дети по длине тела занимают промежуточное положение по отношению к родителям. Таким образом, вероятно, несколько генов отвечают за низкий рост пигмеев. Мы не знаем, каковы именно эти гены, но можем себе представить, что они делают.[170] Тщательные измерения пигмеев (а их измеряли тысячами) показывают, что по сравнению с более высокими людьми пигмеи имеют относительно короткие ноги и относительно длинные руки. Их также отличают размеры головы и зубов, которые оказываются относительно более крупными для их туловища. На самом деле их отличает не только длина тела, но и продольные пропорции, характерные для одиннадцатилетнего британского ребенка.[171] Под «продольными пропорциями» я подразумеваю соотносительные размеры туловища, рук и ног. Мужчины-пигмеи характеризуются широкими грудной клеткой и плечами, как это и свойственно мужчинам вообще; женщины-пигмеи имеют вполне развитые груди и бедра. Но особенности продольных пропорций тела у подростков-пигмеев незамедлительно наводят на мысль о двух возможных причинах того, почему они остаются такими мелкими. Может быть, они просто перестают расти в одиннадцатилетнем возрасте. Или, в качестве альтернативы: возможно, они растут столь же долго, как и люди более высокого роста (до восемнадцати лет или около того), но очень медленно. В принципе, довольно легко провести различия между этими двумя способами оставаться низкорослыми: нужно просто измерить много детей пигмеев определенного возраста и узнать, когда они перестают расти. Но пигмеи не знают, сколько им лет. У них нет календарей, и им безразличны дни рождения. Однако время от времени детей пигмеев все же измеряли. Швайнфурт отдал собаку за пигмея ака по имени Нсевуе и пытался привезти его с собой в Европу, хотя далеко они не уехали, так как мальчик стал жертвой дизентерии. В 1873 году была сделана еще одна подобная попытка, но на этот раз дело кончилось смертью исследователя. Джованни Мани, повторивший путь Швайнфурта, обменял собаку и теленка на двух детей пигмеев ака, Тибо и Шер-Алла, и устремился на север, однако по дороге испустил дух, не вынеся тягот путешествия. Дети тем не менее продолжали путь и в июне 1874 года прибыли в Рим, где были представлены королю Виктору Эммануилу II, а затем вместе с дневниками Мани переданы в дар Итальянскому географическому обществу. Географы, очарованные своим новым приобретением, но не знавшие, что с ним делать, передали детей графу Минискальки-Эриццо, веронскому аристократу. Дети, получившие новые имена Франческо и Луиджи, расцвели в заботливых руках графа и вскоре начали говорить, читать и писать по-итальянски, хотя и весьма своеобразно. Тибо-Франческо выучился играть на пианино и извлекал из инструмента приятные мелодии, хотя размах пальцев не позволял ему брать октаву. Швайнфурт навестил мальчиков в 1876 году и с удовольствием отметил, что встретил их на улице древней Вероны, где они прогуливались с местными дружками. Тибо-Франческо и Шер-Алла-Луиджи, Верона, ок. 1874 г. Из книги Армана де Катрфажа "Пигмеи", 1895 (из собрания автора). Об интеллектуальном прогрессе двух мальчиков было немало написано в научных журналах того времени, не в последнюю очередь потому, что таким образом опровергалось распространенное представление о не слишком высоких умственных способностях пигмеев. В существовании такого мнения отчасти был виновен Швайнфурт, который, хотя, очевидно, и был привязан к Нсевуе, в опубликованных заметках о своем путешествии «Сердце Африки» дал довольно-таки уничижительную характеристику способностям и нраву своего друга. Но ученые люди, бесконечным потоком проходившие через палаццо Минискальки, чтобы посмотреть на Шер-Алла-Луиджи и Тибо-Франческо, меньше интересовались интеллектуальными разговорами мальчиков, чем простыми измерениями их роста, который они определяли, прислонив детей к стенке. Еще до того как их вывезли из Африки, детей измерили по меньшей мере семь ученых; тот же темп сохранялся и в Риме. Возраст мальчиков по-прежнему вызывал сомнения, но считалось, что им было восемь и двенадцать лет, когда они прибыли в Италию, а прожили они там почти шесть лет. По мере их роста выявилась любопытная деталь: у них отсутствовал пубертатный ростовой скачок.[172] Новорожденный ребенок за первый год жизни вырастает на 18 сантиметров. Такая необыкновенная скорость роста сохраняется недолго; год за годом она постепенно падает приблизительно до 5 сантиметров в год. Примерно в возрасте двенадцати лет для мальчиков и десяти лет для девочек эта тенденция меняется на противоположную, и скорость роста резко увеличивается, хотя и на время. Пубертатный скачок роста, знакомый любому подростку, довольно трудно измерить. В 1759 году французский аристократ и друг Бюффона Филибер Гено де Монбейяр (еще один граф) начал измерять своего новорожденного сына и продолжал делать это с шестимесячными интервалами до восемнадцатого дня рождения мальчика. Этот самый юноша в конечном итоге попал под гильотину Робеспьера, но данные о его росте остаются одними из наиболее безупречных сведений подобного рода. Хотя де Монбейяр, или, вернее, описавший результаты Бюффон, не смогли этого обнаружить, данные измерений выявляют великолепный пубертатный ростовой спурт. В тринадцать лет скорость роста сына Монбейяра подскочила до 12 сантиметров в год. Это типично человеческая особенность. Самцы шимпанзе и гориллы в период созревания наращивают мускулы, у павианов вытягиваются морды, но ни у одного из приматов не наблюдается такого прыжка вверх.[173] Пубертатный ростовой скачок вызывается резким увеличением концентрации гормона роста. Тогда можно ожидать, что у пигмеев эти показатели намного ниже, чем у людей более высоких. Любопытно, однако, что это не так. Низкорослость пигмеев, по-видимому, вызвана относительным недостатком другой, способствующей росту молекулы, которая называется инсулинподобным фактором роста-1, или IGF-1. Как явствует из его названия, IGF-1 в структурном отношении близок к инсулину – гормону сахарного метаболизма. Гормон роста регулирует ген IGF, так что концентрации обоих гормонов в кровеносном русле увеличиваются и уменьшаются синхронным образом. Но каждый гормон вносит свой неповторимый вклад в процесс роста.[174] Доказательством этого служит мини-мышь. Обычная лабораторная мышь по окончании роста весит около 30 граммов. Она крупнее, чем домовая мышь Mus musculus, живущая в естественных условиях (на чердаках, в погребах и амбарах). Сладкая жизнь многих поколений мышей в лабораториях мира привела к тому, что мыши, с которыми работают генетики, стали послушными, медлительными и более корпулентными. Как бы там ни было, если у лабораторной мыши путем генетической инженерии сделать дефектным ген рецептора гормона роста (наподобие того, как это происходит естественным путем у эквадорских карликов), то она вырастет только до половины своих нормальных размеров. Если у другой мыши вызвать дефект гена IGF, она достигнет только трети нормальных размеров. Если же скрестить этих двух миниатюрных мышек, то в результате на свет появится мини-мышка с дефектом обоих генов. Ее вес по окончании роста составит всего лишь 5 граммов.[175] Для млекопитающего это ничтожно мало. Почти столько же, а именно 2 грамма, весит самое мелкое из всех млекопитающих – летучая мышь-шмель, или свиноносая летучая мышь, обитающая в Таиланде. Британская пятипенсовая монета весит 3,2 грамма; один евро-цент – 2,4 грамма; американский десятицентовик – 2 грамма. Взрослый человек, будь он того же относительного размера, что и мини-мышка, весил бы столько же, сколько четырнадцатимесячный ребенок. Эти данные говорят о том, что ни пигмеи Конго, ни карлики Эквадора, ни даже сам Йозеф Борувлаский, сколь бы мелкими они ни были, даже не приблизились к пределам человеческой малости. Кретины Открытие Швайнфурта положило начало сезону глобальной охоты за другими пигмеями. Маленькие люди всегда упоминались в дневниках первопроходцев или в местных поверьях то одной, то другой части света. Подобные истории никогда не пользовались большим доверием, но в 1890-х годах были прилежно собраны вместе и проанализированы. Внезапно оказалось, что пигмеи могут жить в Гватемале, на Юкатане, в Каскадных горах Британской Колумбии, Атласских горах Марокко, на Сицилии и в Валь-де-Рибас в Испании. Один археолог заявлял о существовании неолитических пигмеев в Швейцарии.[176] Возможно, все эти маленькие люди были связаны родственными узами; может быть, они сохранились как остатки более древнего и более низкорослого варианта человеческого рода. Однако ископаемые свидетельства говорят об обратном. Рост нашего непосредственного предка Homo erectus составлял около 160 сантиметров; Homo neanderthalensis достиг в высоту примерно 170 сантиметров; первые из анатомически современных людей (кроманьонцы) были лишь ненамного ниже.[177] Конечно, низкорослые люди существуют во всех частях света. Средний рост взрослых мужчин из племени яномамо, обитающего у истоков рек Ориноко и Амазонка, составляет всего 153 сантиметра. Высокогорное население Папуа – Новой Гвинеи, живущее на склонах горы Голиаф, также небольших размеров. Огромные различия среди людей, населяющих земной шар, говорят о том, что рост, которого мы достигаем, очень пластичен. Мы не можем сказать наверняка, что низкорослость эволюционировала независимо у африканских пигмеев и азиатских негритосов, но повсюду в мире она появляется снова и снова. Я сказал «эволюционировала», однако здесь требуется оговорка. Большинство маленьких людей живет в отдаленных и бедных частях планеты. Трудно сказать, насколько бы они выросли, если бы их кормили богатыми белками и калориями продуктами из супермаркетов. Никто, конечно, не верит, что африканские пигмеи станут намного выше, если их в массе перевезти в Калифорнию, но не нужно забывать, что беженцы майя, переехавшие в Лос-Анджелес в 1970-х годах, прибавили около 5,5 сантиметра роста по сравнению с оставшимися в Гватемале родственниками.[178] Вполне вероятно, что если нам еще предстоит обнаружить новое племя пигмеев (оно же, видимо, станет и последним), то может оказаться так, что его представители будут вовсе не пигмеями, а просто людьми с тяжелым и довольно специфическим дефицитом питания. В 1954 году бирманский солдат, маршировавший по горным лесам вдоль совместной границы Бирмы, Индии, Тибета и Китая, наткнулся на деревню маленьких людей. Он не был первым, кто их обнаружил. До обретения Бирмой независимости целый ряд английских путешественников – худощавых одиноких офицеров, служивших в индийской армии, вдоль и поперек исходили регион, где спускаются с Тибетского плато четыре великие реки Азии: Иравади, Салуин, Меконг и Янцзы. Их отчеты немногословны, но едины в своем мнении. Они сообщают о существовании этнически особой группы «карликов», центр расселения которых находится в верхней части долины Тарона, отдаленного притока Иравади. Карликов называли по-разному: дару, нунги, наингвау, кхунунги или киуцу. Они избегали контактов с пришельцами и никем не были подробно изучены, хотя в большинстве рассказов они описываются как жизнерадостные и закаленные люди, разве что чуточку грязные, с татуировками на лицах. Еще сообщалось, что живут они в домиках на деревьях и часто попадают в рабство к более высокорослым горным народам, таким как лису. Некто капитан Б.Е.А. Причард измерил нескольких нунгов и обнаружил, что их средний рост составляет 158 сантиметров. Впоследствии он утонул, пытаясь перейти Тарон вброд, после того как нунги перерезали единственный мост через реку.[179] В 1962 году бирманское правительство решило узнать больше об этих людях. Отряд военных и врачей в течение двух недель карабкался по острым, как лезвие бритвы, хребтам и переправлялся по веревочным мостам через ущелья, добираясь до долины Тарона. Результаты этого исследования опубликованы в одном из самых малоизвестных журналов – «Труды Бирманского медицинского научно-исследовательского общества», но изложены они понятно и доходчиво.[180] Бирманцы обнаружили девяносто шесть человек, живущих в двух деревнях. К всеобщему разочарованию, ни татуировок, ни домов на деревьях исследователи не нашли, но средний рост взрослых мужчин составил 144 сантиметра. Эта цифра соответствовала длине тела самых низкорослых африканских пигмеев. Тем не менее люди, именовавшие себя «таронцы», по названию реки, на которой они жили, с очевидностью относились к тибето-бирманцам и говорили на тибето-бирманском языке. Основой их существования было натуральное хозяйство самого примитивного типа, и жили они в крайней бедности и нищете. По их собственным словам, они пришли сюда из Юннаня три поколения назад. Потом оползень перекрыл дорогу, по которой они шли, и с тех пор они живут в Бирме. Мужчина из племени дару, Тарон. Верхняя Бирма, ок. 1927 г. Из книги Ф. Кингдона Уорда "Рай охотников за растениями", 1927. Но кто они? Бирманцы проанализировали данные и пришли к выводу, что таронцы и нунги, о которых рассказывалось в более ранних сообщениях, – вероятно, одно и то же племя и, следовательно, особая разновидность генетически низкорослых людей. Сколько еще их может быть и каково в точности их происхождение – эти вопросы остались без ответа. Гипотеза, что они настоящие пигмеи, как будто подтверждалась тем фактом, что они жили в тесном соседстве с более высокорослыми людьми, диета которых была не лучше и не хуже их собственной. И все же в истории с таронцами было что-то тревожное. Из девяноста шести человек, живших в двух деревнях, девятнадцать были умственно отсталыми. Это очень высокий процент, даже с учетом их близкородственных скрещиваний (в родословных выявлялось много кросскузенных браков). У некоторых были тяжелые нарушения двигательных нейронов, и они не могли ходить. Сами таронцы уверяли, что когда они жили в Китае, то были нормального роста, а когда перебрались в Бирму, стали маленькими. Это все, что мы знаем о таронцах, и вряд ли в ближайшее время узнаем больше: иностранцам вот уже несколько десятилетий запрещен доступ в Верхнюю Бирму. Вполне возможно, однако, что таронцы – не столько пигмеи или карлики, сколько просто кретины. Это не слишком приятное, зато верное определение. Кретины – это люди, которые от рождения страдают комплексом неврологических и ростовых нарушений. По традиции различают два типа больных: «неврологические» кретины – те, кто страдает умственной отсталостью, тяжелыми заболеваниями двигательных нейронов или глухонемотой, и «микседематозные», которые характеризуются сильным отставанием в росте, сухой кожей, отсутствием ресниц и бровей и задержкой полового созревания. Особенно тяжелая форма микседематозного кретинизма, при которой рост и половое развитие детей попросту останавливаются примерно в девятилетнем возрасте, наблюдается в северном Конго. Эти конголезские кретины даже по достижении двадцатилетнего возраста не обнаруживают никаких признаков роста молочных желез или волос на лобке, менструаций или эякуляций и никогда не вырастают выше 100 сантиметров. Это, конечно, крайность, но у таронцев может быть более легкая форма той же болезни.[181] Кретинизм – это глобальное бедствие. В 1810 году Наполеон Бонапарт приказал провести обследование жителей швейцарского кантона Валэ, в результате которого его ученые выявили 4 тысячи кретинов среди 70 тысяч обитателей кантона. Ключом к разгадке служит место обитания. Как долина Тарона лежит в предгорьях Гималаев, так и Валэ расположен у подножия Альп. В Швейцарии случаев заболевания не зарегистрировано с 1940-х годов, но пояс кретинизма все еще проходит по большинству других великих горных хребтов: Анд, Атласских гор, высокогорных районов Новой Гвинеи, Гималаев. Микседематозные кретины приблизительно в 20-летнем возрасте и здоровый мужчина. Демократическая Республика Конго (Заир), ок. 1968 г. Франсуа Деланж (Международный совет по контролю за йододефицитными заболеваниями, Брюссель). Признак, который объединяет все эти области, – отсутствие йода в почве. И люди и животные рассчитывают получать с пищей необходимое количество йода, но во многих частях света, в особенности в высокогорье, оледенение и дожди вымывают йод из почвы, так что его становится мало в растениях. Кретинизм обусловлен диетой с низким содержанием йода. В масштабах планеты около одного миллиарда людей рискуют заболеть от йодного дефицита, 6 миллионов страдают кретинизмом. В готическом соборе Аосты, которая находится в десяти километрах юго-восточнее Монблана, сиденья для певчих украшены портретами кретинов. Они вырезаны для того, чтобы напомнить публике XV века о тяготах адских мучений: местный вариант фантастических и демонических созданий, обычно изображаемых в монастырских трапезных. Многие кретины снабжены любопытной деталью – выступающими, бесформенными шеями. У одного даже вырезан настоящий кожный мешок, состоящий из двух долей и свисающий с шеи, настолько большой, что его надо было поддерживать двумя руками. Примерно через сто лет после того, как был построен собор в Аосте, Шекспир напишет в «Буре»: ...Мы в детстве Не верили, что люди есть в горах С подгрудками, как у быков, с мешками Мясистыми у горла...[182] Кретины Аосты и шекспировские горцы страдали зобом. Зоб – это внешнее проявление разросшейся щитовидной железы, органа, напоминающего по форме бабочку и расположенного чуть выше ключиц. Подобно кретинизму, это верный признак йодной недостаточности. Открытая в 1611 году, щитовидная железа поначалу считалась своеобразной поддержкой для горла, чем-то вроде косметического приспособления, чтобы придать ему лучшую форму. В действительности эта железа производит и секретирует гормон под названием «тироксин». Для выработки гормона щитовидной железе нужен йод, и если его мало, железа пытается компенсировать этот дефицит довольно-таки радикальным способом: становясь больше. В результате шея сперва распухает, затем начинает выступать наружу, и, наконец, у пожилых людей, всю жизнь испытывавших недостаток йода, образуется огромный тканевый мешок, который свисает от подбородка до груди и содержит колоссальное количество тиреоидных узелков. Одни из них увеличиваются, другие отмирают, третьи расходуются. В Англии это называется «дербиширская шея».[183] Иметь зоб некрасиво, но полезно, в особенности беременным женщинам. Тироксин – это еще один гормон, хотя и не белковой природы, который способствует клеточной пролиферации в костях плодов и растущих детей. Он также контролирует количество клеток, которые мигрируют к ростовой пластинке, чтобы разрастись и умереть перед формированием кости. Плод получает нужный ему тироксин от матери. Если же этого количества недостаточно, то ребенок родится кретином. Недостаток йода в пище ребенка также может привести к кретинизму. Кроме того, кретинизм может быть, хотя и редко, генетического происхождения. Известно много мутаций генов человека, которые нарушают продукцию тироксина, механизмы его хранения и переноса в организме или его способность связываться с рецепторами.[184] Существует также целый класс мутаций, намного более вредоносных, чем те, которые просто вызывают нарушения в работе щитовидной железы. Эти мутации поражают гипофиз. Среди гормонов, продуцируемых гипофизом, есть один, который контролирует работу щитовидной железы. Этот гормон, тиреотропин, регулирует механизм поглощения йода щитовидной железой, скорость, с которой она продуцирует тиреоидные гормоны, и то, как она по мере необходимости разрастается или сжимается. Гипофиз – это орган контроля и поддержания равновесия по отношению к щитовидной железе. Зоб – свидетель ее функционирования. Гипофиз следит за уровнем тиреоидных гормонов, циркулирующих в организме, и в случае обнаружения их нехватки начинает продуцировать тиреотропин, который затем побуждает щитовидную железу к еще более интенсивному функционированию, в крайнем варианте приводящему к образованию зоба. Дети с дефектами гипофиза становятся карликами из-за недостатка гормона роста и кретинами из-за недостатка тироксина.[185] Но подавляющее большинство известных в мире случаев заболевания кретинизмом вызвано простой нехваткой пищевого йода. Трагедия 6 миллионов кретинов состоит в том, что способы лечения и профилактики заболевания хорошо известны и практически ничего не стоят: нужна просто йодированная соль. Именно предписанное законом использование йодированной соли привело к исчезновению в Европе в начале XX столетия зоба и кретинизма. Это произошло на протяжении жизни одного поколения, и ныне эти заболевания сохранились разве что в народных преданиях. Действительно, случаи йодного дефицита сегодня настолько забыты в развитых странах, что за пределами медицинского и научного сообщества слово «кретин» существует лишь как случайно брошенное оскорбление. Более того, это слово сохранилось, хотя многие подобные эпитеты были справедливо признаны недопустимыми для использования в приличном обществе. У него просто нет лобби, нет защитников. Являются ли жители долины Тарона из Верхней Бирмы кретинами? Может быть, их низкорослость – это часть грандиозного и прекрасного ковра под названием «генетическое разнообразие человечества»? Или же они просто своеобразные жертвы скудной высокогорной жизни? И если мы узнаем, что племени маленьких людей в головокружительных ущельях Иравади больше не существует, то что нам делать – радоваться или огорчаться? Il coltello[186] Почти двадцать пять столетий назад, работая на далеком Эгейском острове, Аристотель пришел к заключению, которое можно одновременно счесть банальным, замечательным и ужасным. «Все животные, – писал он, – если они прооперированы в молодом возрасте, становятся крупнее и привлекательнее своих непокалеченных собратьев; если же их прооперировать, когда они уже полностью выросли, то никакого увеличения в размерах не последует... Можно вывести общее правило: изувеченные животные вырастают до большей величины, чем неизувеченные». Под «увечьем» Аристотель подразумевал кастрацию. Отсюда и банальность этого наблюдения, которое просто повторяло то, что и так было хорошо известно греческому фермеру в IV веке до н.э., равно как и его современному потомку. Примечательность этого заключения в том, что Аристотель решился его записать. Он взял привычную для скотного двора истину, что выхолощенные бараны, жеребцы и петухи становятся крупнее обычных животных, и вывел из этого научное обобщение, причем такое, которое сохраняет свой смысл и по сей день. Ужасным это высказывание делает то, что, говоря о животных, Аристотель подразумевал и человека.[187] Мальчики, которых кастрируют до наступления полового созревания, вырастают высокими, можно сказать – необычайно высокими. В настоящее время мало кто об этом знает, однако в Афинах IV века сей факт был известен каждому – город кишел рабами, свезенными со всего Средиземноморья, в числе которых было много евнухов. Знали об этом и вращающиеся в свете итальянцы XVIII столетия. В великих оперных театрах, таких как «Ла Скала», царили не теноры, как это происходит сейчас, а, скорее, кастраты. Прославляемые за диапазон, силу и неземные свойства своих голосов, некоторые кастраты становились богатыми, знаменитыми и влиятельными людьми. Фаринелли пел для испанского короля Филиппа V и был награжден титулом кабальеро; Кафарелли стал герцогом и отстроил себе дворец в Неаполе; Доменико Мустафа стал папским рыцарем и штатным директором хора понтифика. Россини, Монтеверди, Гендель, Глюк, Моцарт и Мейербер – все писали музыку специально для кастратов. Когда они пели, зрители в ложах кричали: «Eviva il coltello!» – «Да здравствует скальпель!» – и сходили с ума от восторга. Кастрат Сенезино в опере Генделя «Флавио», Лондон, ок. 1723 г. Приписывается Уильяму Хогарту (Музей Виктории и Альберта, Лондон). Рост итальянских кастратов никогда не измерялся, поэтому мы в точности не знаем, насколько высокими они были. Но по многочисленным анекдотам и изображениям можно судить, что они были выше своих современников и отличались несколько своеобразным телосложением. На гравюре, приписываемой Хогарту, показан кастрат, исполняющий одну из партий в опере Генделя. Раскрыв рот в звенящем бельканто и застыв в нелепой позе с широко расставленными ногами и упертыми в бока руками, он башней высится над другими артистами. Это карикатура, и притом жестокая, тем более что кастраты страдали не только от неэлегантного внешнего вида. Помимо прямых последствий откровенно жестокой операции и невозможности жениться или стать отцом, старение часто сопровождалось для них жестокими кифозами и сгорбленными спинами, явными симптомами остеопороза – болезни, которая обычно является уделом пожилых женщин. У многих кастратов также развивались большие, отвисшие груди. Правда, они никогда не лысели и не заболевали раком простаты, но это была не слишком большая компенсация за причиненные увечья. В Италии XVIII века около 4 тысяч мальчиков в год теряли свое мужское достоинство ради сохранения ангельских голосов. Немногие из них получали награды, которые могли бы оправдать такую жертву. Почему кастраты были такими высокими? Итальянские кастраты вышли из моды, а сама операция была запрещена папой Пием X в 1920 году. Последний ватиканский кастрат Алессандро Морески умер в 1922 году. Но в других странах сотни, если не тысячи мужчин, кастрированных в детстве, жили на протяжении почти всего XX века. Это были придворные евнухи, и их встречалось немало. К моменту отречения у китайской императорской семьи, последних отпрысков династии Кинг, в Запретном городе в Пекине находилось в услужении до 2 тысяч евнухов. Последнего придворного китайского евнуха Сунь Яотина похоронили только в 1996 году – вместе с его яичками, которые тщательно сохранялись в специальном сосуде. Около двухсот евнухов жило во дворце Топкапи в Стамбуле вплоть до 1924 года, то есть до изгнания султана, которому они служили. Вообще же на обширных территориях, которые некогда контролировала Блистательная Порта, должно быть, насчитывалось намного больше евнухов. В 1920-х годах часть стамбульских евнухов была тщательно обследована группой немецких врачей. То, что они обнаружили, казалось действительно странным. Эти пожилые люди, последние в ряду евнухов, непрерывно служивших своим римским, византийским и османским хозяевам, имели кости подростков. По мере приближения поздней фазы подросткового периода у детей постепенно закрываются ростовые пластинки – источник клеток, стимулирующих рост кости. Именно по этой причине рост в конце концов прекращается. На рентгенограммах видно, как далеко зашел этот процесс; по ним можно даже определить «костный возраст» ребенка. Если у восьмилетних детей на каждом конце длинных костей имеются широкие ростовые пластинки, то у четырнадцатилетних они сужаются, а у восемнадцатилетних почти или полностью зарастают. Стопка рентгенограмм свидетельствует, что у стамбульских евнухов ростовые пластинки так и не закрылись. Напрашивается ясный, хотя и слегка неожиданный вывод: из-за отсутствия тестикулов эти люди никогда не переставали расти. Таким образом, яички – это не только источник гормональных сигналов, регулирующих половую принадлежность индивида, но также поставщик как минимум одного гормона, который в конце периода отрочества отдает приказ костям закрыть ростовые пластинки и прекратить рост. Природа этого гормона стала очевидной в 1994 году, когда к врачу из Цинциннати обратился пациент с типично евнухоидными чертами – диспропорционально длинными конечностями, несмотря на наличие у мужчины двух неповрежденных и с виду здоровых яичек. Ему было двадцать восемь лет, и длина его тела составляла 204 сантиметра. Конечно, он был высоким, но не чрезмерно. Необычным было то, что, судя по его водительским правам, его рост в шестнадцать лет составлял всего лишь 178 сантиметров. Иными словами, за прошедшие двенадцать лет он каким-то образом вырос практически на 22 сантиметра. Выявленный при обследовании сбой молекулярного механизма был удивителен своей неожиданностью: мутация рецепторов эстрогена.[188] Мы считаем эстрогены – эстрадиол и эстрон – типично женскими гормонами, каковыми они, по сути, и являются. Это гормоны молочных желез, менструаций, беременности и менопаузы. Однако у мужчин эстрогены также продуцируются, притом в больших количествах: именно из них вырабатывается тестостерон.[189] Далеко не все имеющиеся у мужчин эстрогены подвергаются трансформации, часть из них остается и играет важную роль в прекращении роста костей. В последние годы были обнаружены еще двое мужчин – один в Японии, другой в Нью-Йорке, не способных продуцировать эстроген из-за отсутствия одного фермента. Оба они также перешагнули за двадцать и продолжали расти.[190] С другой стороны, у детей с избыточной продукцией эстрогена пубертат начинается и заканчивается очень рано. Они растут быстро, но недолго, в результате чего на всю жизнь остаются низкорослыми. Однако существуют и другие факторы остановки роста помимо эстрогена. Тестикулярный эстроген, конечно, приказывает костям подростков закрывать зоны роста и прекращать расти, но все же мужчины без эстрогена или с дефектом его рецепторов не растут всю жизнь со скоростью 2,2 сантиметра в год. Евнухи, охранявшие гаремы Османской империи, вершившие делами в Поднебесной и возвышавшиеся на сцене «Ла Скала», хотя и были внушительных размеров, но все-таки не достигали 2 метров 70 сантиметров роста. Это происходит, наверное, потому, что после окончания подросткового периода концентрация IGF1 в крови снижается, вызывая общее замедление скорости клеточных делений во всем теле. Именно так, вероятно, все и происходит. Что значит быть нормального роста Гормон роста и IGF – крайне мощные, стимулирующие рост молекулы. Чтобы ребенок вырос до положенного ему размера, важно их постоянно контролировать. В противном случае процесс становится неуправляемым, и начинается рост без сдержек и противовесов, или то, что обычно называется «рак». Среди механизмов, с помощью которых организм ограничивает способность IGF1 к стимулированию пролиферации клеток, имеется белок под названием PTEN (phosphatase and tensin homolog). Дети, рождающиеся с одной дефектной копией гена PTEN, демонстрируют вначале не много признаков, что с ними не все в порядке: в худшем случае череп у них может быть несколько крупнее обычного. Проблемы возникают позже, когда, как это с неизбежностью происходит, в нескольких клетках растущего организма мутирует вторая копия гена. В этих клетках и в их потомках из-за недостатка белка PTEN начинается неконтролируемое деление клеток, в результате чего в слизистой оболочке рта, толстого кишечника, в молочных железах, яичниках, щитовидной железе и, странным образом, в волосяных фолликулах образуется довольно-таки редкостный набор опухолей. Эти виды рака часто приводят к смерти. Однако наследование дефектной копии гена PTEN может привести к еще более ужасным последствиям. Если вторая мутация произойдет в исходных клетках зародыша (а не в более позднем периоде детства), значительная часть, а может быть, и половина детского организма будет полностью лишена белка PTEN. Эта пораженная часть тела станет, по сути, одной огромной и неуклонно распространяющейся опухолью. Это заболевание известно под названием синдрома Протея, по имени самого непостоянного из греческих богов.[191] ...Есть же, которым дано обращаться в различные виды, – Ты, например, о Протей, обитатель обнявшего землю Моря! То юношей ты, то львом на глаза появлялся. Вепрем свирепым бывал, змеей, прикоснуться к которой Боязно, а иногда ты рогатым быком становился,[192] – писал Овидий, в других местах подчеркивавший «многоликость» морского бога. Синдром Протея – очень редкое заболевание; во всем мире насчитывается не более шестидесяти человек с этим диагнозом. Дети с этим синдромом при рождении выглядят вполне нормально, но с возрастом у них начинают наблюдаться аномалии лица и конечностей, которые прогрессируют по мере того, как хаотические разрастания костной и мягких соединительных тканей распространяются по всему телу, нередко только с одной стороны. У них образуются большие участки сморщенной, иссеченной кожи, в особенности на подошвах ног. Обычно дети умирают, не дожив до пятилетнего возраста: у некоторых мозговые полушария становятся разного размера, и они умирают от судорожных припадков; другие не могут дышать из-за разросшихся ребер; третьи гибнут от того, что одна из многих опухолей, к которым они склонны, перерождается в злокачественную. Сейчас многие считают, что Джозеф Меррик[193], умерший в 1890 году в возрасте двадцати восьми лет, страдал синдромом Протея.[194] Если это так, тогда в каком-то смысле ему повезло, что он дожил до такого возраста. Синдром Протея. Джозеф Меррик (1862-1890). (Королевская больница Лондона) Тесная связь между ростом и раком показана на собаках. У щенков немецкого дога в крови содержится намного больше IGF, чем у щенков чихуа-хуа, в результате чего первые растут в восемь раз быстрее и становятся в десять раз больше. Но за это они платят дорогую цену. Немецкие доги, ньюфаундленды, сенбернары и собаки многих других гигантских пород рискуют заболеть остеосаркомой, или раком кости, в восемьдесят раз чаще, чем маленькие собачки. Рак почти всегда начинается на одной ноге, и только ее ампутация может предотвратить его распространение. Остеосаркома – также один из самых распространенных типов рака у детей. Как и у собак, болезнь обычно начинается на костях ног и, как правило, во время пубертатного скачка роста, когда клетки ростовых пластинок наиболее интенсивно делятся. В Хантеровском музее, неподалеку от скелета Чарльза Берна есть витрина, в которой находятся препараты рассеченной грудной клетки и гортани, которые принадлежали молодому человеку, умершему от прогрессирующей остеосаркомы. Этим экспонатам, и без того зловещим, добавляет ужас то, что они покрыты твердыми серыми узелками, напоминающими кусочки угля. Это вторичные опухоли, скопления костеобразующих клеток, метастазировавших из первичной опухоли на ноге, которую Хантер пытался вылечить путем ампутации. У детей, как и у собак, размеры тела являются риск-фактором по развитию рака. Больше 50 процентов случаев заболеваний встречается у детей, которые по длине тела находятся на уровне 75-го перцентиля для своей возрастной группы.[195] Крупные собаки и высокие дети могут быть более подверженными заболеванию раком просто потому, что у них большее количество клеток, чем у мелких собак или менее рослых детей. Вероятнее, однако, что опасны не просто большие размеры per se[196], а скорее высокие концентрации гормона роста и IGF, которые свойственны крупным собакам и детям. Опухоли гипофиза такого типа, как тот, что, вероятно, был у гиганта Чарльза Берна в детстве, иногда встречаются и у взрослых. Подобно случаю с Берном, они продуцируют большое количество гормона роста, но не вызывают увеличения общих размеров из-за того, что зоны роста длинных костей уже закрыты. Вместо этого начинают расти только кости челюстей, кистей и ступней. Это состояние известно как акромегалия. Часто первым признаком того, что у взрослого человека может быть опухоль гипофиза, является необходимость постоянно приобретать туфли большего размера. Опухоль гипофиза – это довольно опасная и сама по себе неприятная вещь. Но она имеет еще и малоприятные косвенные последствия, которые выражаются в увеличении частоты заболеваемости раком толстой кишки, груди и крови (лейкемии). Эти случаи рака вызваны не метастазированием опухоли гипофиза, которая является доброкачественным образованием, а скорее тем, что она делает: а именно, стимулированием всей системы гормоном роста IGF. Почему это вызывает высокий процент рака, до сих пор неясно. Есть одна идея, что IGF не позволяет больным клеткам погибать. Клетки, пораженные потенциально канцерогенной мутацией, часто совершают самоубийство. IGF аннулирует этот альтруистический импульс, поэтому люди с акромегалией, крупные собаки и высокие дети относительно склонны к развитию рака. Нужно, конечно, внести ясность и в то, какова степень этого риска. Из всего спектра заболеваний, которых могут опасаться родители, роль детского рака наименее значительна. Остеосаркома при всей своей пагубности и агрессивности встречается крайне редко: она поражает лишь одного ребенка из 300 тысяч. Родители высоких подростков не должны об этом беспокоиться, а вот владельцы крупных собак как раз должны.[197] Плохие новости для крупных собак на этом не кончаются. Многие люди покупают для своих питомцев страховые полисы, чтобы их преданные компаньоны не разорили бы их, как, например, в таких довольно глупых случаях, когда собаке делают коронарное шунтирование. Страховые компании, всегда стремясь свести собственные риски к минимуму, составили обширную базу данных о здоровье и смертности своих клиентов (собак, а не выплачивающих страховку людей). Эти материалы четко свидетельствуют, что вне зависимости от риска развития остеосаркомы большие собаки стареют быстрее, чем маленькие. Немецкие доги, ньюфаундленды и сенбернары в среднем живут от четырех до пяти лет; чихуа-хуа и карликовые пудели – примерно на десять лет дольше. Существует около четырехсот различных пород собак: на каждый килограмм веса, которым одна порода превосходит другую, она теряет восемнадцать дней жизни.[198] Эти результаты как будто бы говорят нам, что быть крупным в целом вредно для здоровья. Однако это всего лишь корреляция. Породы собак отличаются друг от друга таким количеством разных особенностей, что приписывать разницу в продолжительности жизни одним только размерам тела довольно-таки трудно. Десятитысячелетняя история разведения собак – прекрасный пример естественного эксперимента, хотя, подобно другим естественным экспериментам, это, можно сказать, вовсе и не эксперимент, по крайней мере если под таковым подразумевать некую контролируемую манипуляцию. К счастью, известны результаты настоящих экспериментов с карликовыми и гигантскими мышами. Мышки-мутантки, которые отличаются малой величиной из-за недостатка гормона роста, также живут на 40 процентов дольше своих братьев и сестер нормального размера. И наоборот, мыши, с помощью генетической инженерии ставшие гигантами, быстро стареют и умирают. Каковы бы ни были причины обратной связи между размерами тела и старением, она, по-видимому, существует у всех млекопитающих.[199] Я поражен этими результатами. Если это верно для собак и мышей, то почему не для людей? Может быть, невысокие люди генетически предрасположены к более долгой жизни, чем их более крупные собратья? Некоторые ученые думают именно так. Они приводят в пример семейство с дефектом гипофиза, которое живет на адриатическом острове Крук. Все члены этой семьи, невзирая на то, что они страдают одновременно и карликовостью и кретинизмом, характеризуются высокой продолжительностью жизни по сравнению с населением Хорватии в среднем.[200] Другой пример касается исследований американских бейсболистов, в которых показано, что игроки маленького роста живут на восемь лет дольше высоких. Оно, может быть, и так, но объемы выборок в вышеупомянутых работах невелики, а массовые обследования национального масштаба, проведенные в Норвегии, Финляндии и Великобритании, систематически свидетельствуют о наличии прямо противоположной тенденции. Это не должно удивлять. Большая часть популяционной изменчивости в росте и состоянии здоровья объясняется социально-экономическими факторами.[201] Быть бедным – значит иметь маленький рост и высокий риск развития практически любого заболевания, которое может прийти на ум. Эта закономерность попросту перечеркивает любую противоположно направленную генетическую тенденцию, если таковая существует. Будут ли бедные всегда низкорослыми? Вероятно, нет. Рост молодого голландца сегодня в среднем равняется 184 сантиметрам. Это делает голландцев самыми высокими людьми в мире, обогнавшими скотоводов племени динка и воинов-масаев. И они продолжают расти: к 2012 году средняя длина тела голландских мужчин составит 186 сантиметров, а женщин – 172 сантиметра. Буквально на днях высоким активистам удалось убедить голландское правительство изменить стандарт на высоту потолков в национальных строительных нормативах, приподняв их на 20 сантиметров. Это превосходство в росте можно отчасти объяснить тем, что Голландия – северная страна с большим количеством коров. Люди, живущие на севере, генетически предрасположены быть выше, чем, скажем, их соседи с юга бельгийцы, каковые, в свой черед, обгоняют в росте южных соседей, французов. Голландские дети также характеризуются высоким уровнем потребления животных белков, которые им поставляют все эти мирные черно-белые коровки, придающие столь специфический вид голландскому пейзажу. Кроме того, Голландию отличает благосклонная атмосфера в отношении наркотиков. Но географических особенностей Голландии, вероятно, недостаточно для объяснения того количества добродушных белокурых гигантов, которых сегодня можно увидеть в университетских кампусах. В течение многих лет страна имеет такую систему здравоохранения, которая характеризуется высоким уровнем развития, эффективностью и общедоступностью, хотя и ложится тяжелым бременем на кошельки налогоплательщиков. Именно эта система вносит свой вклад в общие показатели роста ее юных обитателей. Не менее замечательно и то, что сейчас больше нельзя судить о социально-экономическом статусе голландских детей по их росту. Десятилетия социальных реформ уничтожили различия, которые существовали в этой стране (как и во всех остальных) в течение тысячелетий. Равенство распространилось до самых костей.[202] По-иному обстоят дела в большинстве других стран. В них богатые остаются высокими, а бедные – низкими. Рост молодого англичанина в среднем 176 сантиметров, на целых 8 сантиметров ниже, чем у юноши-голландца. Англия представляет собой исключение также и в отношении того правила, что северяне всегда выше южан. Обитатели Голландии могут быть выше французов, а крестьяне Сычуаня – выше кантонцев, но йоркширский мужчина уступает в росте жителю Эссекса, а средний шотландец ниже их обоих. Конечно, свой вклад могут вносить генетические различия – наличие кельтских или саксонских генов, но большинство экспертов в области общественного здравоохранения подчеркивают, что причиной различий в росте является бедность северных областей Британии. Один печально известный факт: обитатели некоторых, особенно заброшенных муниципальных кварталов Глазго могут пройти до пяти километров в любую сторону и не найти в продаже ничего съедобного, кроме капусты. Бедность и низкий рост издавна отличали население Северной Англии. Более ста пятидесяти лет назад северные города Лидс и Манчестер стали местом проведения первого серьезного обследования роста британских детей. Именно в это время социальный реформатор Эдвин Чедвик изучал условия жизни детей, работавших на ткацких фабриках. По современным стандартам фабричные дети были невероятно маленькие. Во всех возрастах длина их тела была ниже уровня 3-го перцентиля для современных британских детей, причем эти различия сохранялись на протяжении всего периода роста, так что восемнадцатилетний фабричный юноша вырастал в среднем всего лишь до 160 сантиметров. В 1833 году, когда Чедвик опубликовал свой отчет, британский парламент принял билль, запрещавший использовать в промышленности труд детей до наступления девятилетнего возраста.[203] Именно исторические положительные ассоциации между состоянием здоровья и ростом объясняют широко распространенные убеждения в привлекательности больших размеров тела. От Джорджа Вашингтона до Джорджа Уокера Буша было сорок три президента США. Рост сорока из них превышал соответствующие средние значения для американских мужчин. Джеймс Мэдисон знаменит тем, что его рост составлял всего лишь 164 сантиметра, но ведь он был также архитектором национальной конституции. Избиратели активно голосуют, в том числе и за рост: сорок из сорока трех победивших на выборах были выше своих ближайших соперников. Женщины во всех культурах отдают предпочтение мужчинам, которые в среднем на 5 сантиметров превосходят их в росте. Профессора, которые, казалось бы, должны ценить интеллект превыше всего остального, поступают точно таким же образом. Профессора американских университетов в среднем на 2 сантиметра выше ассистентов, а заведующие кафедрами выше и тех и других. При ответе на вопрос, какой рост они хотели бы иметь, американские мужчины даже средних размеров неизменно говорили, что желали бы стать выше. И кто может их в этом упрекнуть?[204] Столь распространенное обаяние высокого роста ставит нас перед дилеммой. Поскольку наши знания о молекулярных механизмах, контролирующих рост, становятся все глубже, мы вскоре сможем с большой точностью изменять размеры, до которых мы, а вернее, наши дети должны вырасти. Но какого роста мы должны быть? Граница между нормальной и патологической длиной тела никогда не бывает четко определена: это некая «серая» зона, которая находится под влиянием клинических возможностей или даже простого удобства. Конечно, существует множество заболеваний, генетической или иной природы, при которых низкорослость является симптомом. Однако низкорослость, хотя бы и генетического происхождения, далеко не всегда болезнь, иными словами – в большинстве своем таковой не является. В Соединенных Штатах около 30 тысяч детей с отставанием длины тела, чтобы вырасти, в настоящее время получают добавки рекомбинантного гормона роста. Большинство этих детей отличает дефицит гормона роста, и для них такое лечение вполне показано. Но около трети от общего количества характеризуются так называемой «идиопатической низкорослостью». Это означает, что они маленькие не потому, что недоедают, или их обижают, или у них имеется какая-то клинически диагностируемая патология, – они просто мелкорослые. Гормон роста они получают по желанию родителей, которые хотят видеть своих детей высокими.[205] Я сомневаюсь, правильно ли это. Гигантские собаки и карликовые мыши свидетельствуют о том, что воздействие гормона роста на организм нами еще до конца не понято. Имея это в виду, я уверен, что никто не обвинит меня в радикализме или консерватизме, если я выскажу мнение, что мы не должны манипулировать длиной тела детей без достаточных на то медицинских показаний. Это касается не только гормона роста. По мере того как мы все больше узнаем о молекулярных механизмах, регулирующих размеры тела, соблазн немедленно применить их постоянно растет. Грань между нормой и патологией не просто размыта; она подвижна, все время меняется и зависит от технического прогресса. В каком-то смысле так и должно быть. Трансформация биологической случайности в конкретное, поддающееся излечению заболевание – это характеристика всей истории медицины. Произойдет ли то же самое с длиной тела? Высокий рост может коррелировать с огромным разнообразием привлекательных вещей, и немногие коротышки имеют шанс стать президентами Соединенных Штатов, но на самом деле это не слишком уж интересное наблюдение. Изучение детей с низким ростом показало то, о чем можно было и так догадаться: из всего, что снижает шансы ребенка на счастье и успех в жизни, рост – это самый малозначащий фактор; он куда менее важен, чем интеллект, здоровье и качество ухода, который ребенок получает от родителей. Об этом мы должны помнить, когда с гордостью или тревогой следим за прогрессом нашего ребенка по отметкам на дверном косяке. Глава VII Желание и поиск целого [о гендере] Спящий гермафродит. По мотивам Никола Пуссена, 1693 (Библиотека Уэллком, Лондон). В феврале 1868 года парижский консьерж вошел в один из номеров дома по улице л'Экольде-Медисин, находившихся под его присмотром. В комнате – простой мансарде, темной и убогой, – почти ничего не было: только кровать, небольшой столик, печка, которая отапливалась углем и газом, и еще – труп. Цианисто-голубой цвет кожи и засохший сгусток крови на застывших губах свидетельствовали, что причиной смерти была печка. Труп принадлежал двадцатидевятилетнему мужчине по имени Абель Барбен. Следователь назовет смерть самоубийством, и, вне сомнения, так оно и было. Но, как станет ясно из результатов вскрытия, описанных будничной прозой патологоанатомического отчета, смерть Абеля Барбена была не просто трагедией, вызванной обычным сочетанием бедности и одиночества, но и следствием ошибки, случившейся три десятка лет назад. Это был долго не проявлявшийся эффект мутации, которая вызвала дефект, и очень серьезный, одного-единственного фермента в организме Абеля Барбена, причем произошло это где-то в апреле 1838 года, за семь месяцев до его рождения. Во всяком случае нам известно, что его мать, впервые поднеся к груди будущего Абеля Барбена, была уверена, что держит на руках не сына, а малютку-дочку. В этой главе рассказывается о механизмах, которые определяют пол человека, и о том, что случается, если они дают сбои; об ошибках, которые происходят в такой деликатный момент жизни плода, когда имеющие место события – сцепление молекул между собой – решают его дальнейшую судьбу, то, кем он станет – мальчиком или девочкой. Эта глава о генетических ошибках, которые начинаются с анатомических нарушений, а заканчиваются необычными желаниями. "Посему оставит человек отца своего и мать и прилепится к жене своей, и будут двое одна плоть". Да, но только в том случае, если он на это способен: библейское предписание, выраженное с такой легкостью, предполагает, что это есть нечто само собой разумеющееся. Как и то, что мы знаем, кем должны быть – мужем или женой, ибо плоть позволит нам стать с другим тем, что мы есть. Но некоторые из нас ничего этого не знают, и плоть не дает им разрешения на такой союз. Когда дело доходит до секса, никакие ошибки не прощаются. Дитя, которое станет Абелем Барбеном, родилось в Сен-Жан-д'Анжели, тихом и довольно скучном городке на прибрежной равнине Шарант, в 400 километрах к юго-западу от Парижа. При крещении малютке дали имя Эркюлин Аделаида Барбен, хотя впоследствии она будет называть себя Алексиной. По ее собственным словам, у нее было счастливое детство. По крайней мере, так оно ей вспоминалось годы спустя, когда она писала свои мемуары. Ей исполнилось двенадцать, и она была влюблена: Я обрушила на нее привязанность, которая была одновременно идеальной и страстной. Я была ее рабой, ее преданным и благодарным псом. Мне хотелось рыдать от счастья, когда она склонялось ко мне с мягким, ласковым выражением на лице и я видела рядом ее длинные, безупречные по форме ресницы. Предметом страсти Алексины была старшая по возрасту подружка, дочь местных аристократов. Блондинка, наделенная изысканной красотой, она была слегка апатична, с предрасположенностью к чахотке. Алексина же была темноволосой, смуглой и угловатой – по крайней мере, согласно ее же словам. Но что еще важнее – она была из бедной семьи и в школу, где в основном учились дети местных богатых буржуа и знатных семейств, ее взяли из милости. Если фразы, которыми она описывает свою любовь, несут оттенок мелодрамы, следует помнить, что язык романтизма был вполне естественным способом выражения чувств для французской школьницы 1850-х годов. На этом языке любить, любить по-настоящему означало прославлять предмет этой любви и принижать себя, любить без надежды на взаимность (можно вспомнить "О любви" Стендаля). Что же до страстной дружбы, то она не казалась чем-то странным. Алексина была образцовой ученицей, любимицей воспитывавших ее урсулинок. Правда, она иногда ускользала ночью в келью своей белокурой подружки (и, когда ее там застигли, едва не была наказана: обожавшая ее и обожаемая ею мать-настоятельница хотела лишить ее первого причастия). Но, несмотря на такие проступки, она хорошо училась и в семнадцать лет была отправлена в соседний городок Ле-Шато, где должна была продолжить образование и стать учительницей. Здесь завязалась другая дружба, носившая откровенно более сексуальный характер. Это куда больше беспокоило монахинь. Время от времени учительница останавливала на мне свой взгляд в тот момент, когда я наклонялась к Текле, чтобы поцеловать ее, иногда в бровь, а иногда – в это трудно поверить! – в губы. Так повторялось раз по двадцать в час. В наказание я должна была сидеть в дальнем конце сада, но я не всегда выполняла это со смирением. Беспокоило и то, что у Алексины не начинались менструации. В своем дневнике она упоминает об этом факте иносказательно и стыдливо, но смысл ее слов абсолютно ясен. Лекарства и диеты не приносили никакой пользы. Внешний вид также отличал ее от подружек. В то время как они расцветали и приобретали женственную округлость форм, она оставалась худой и угловатой. У нее усилился рост волос, и ей приходилось брить верхнюю губу, щеки, руки, чтобы избежать насмешек. Жизнь в монастыре таила в себе и другие муки. Например, походы к морю: девочки снимали одежды и, оставшись в нижних юбках, плескались в волнах. Алексина в одиночестве наблюдала за ними, боясь раздеться, вся во власти "беспокойных чувств". Она видела тревожные сны. В следующем, 1857 году Алексина Барбен получила должность помощницы учительницы в женской школе. Тогда же началась любовная связь, приведшая ее к гибели. Ее возлюбленной стала девушка по имени Сара, такая же юная учительница, как и сама Алексина. Их кровати помещались в соседних спальнях. После мгновенного сближения эта дружба переросла в нежные ухаживания. Вскоре Саре было запрещено самой одеваться: одна только Алексина могла зашнуровывать ее корсет, не без того, чтобы в это же время запечатлеть поцелуй на обнаженной груди подруги. Новые поцелуи следовали во время прогулок в дубовой роще. Их страстность смущала, но не отталкивала Сару. За ними следовали пылкие признания: "Я иногда завидую мужчине, который будет твоим мужем". И вот однажды ночью Алексина получила все, и они с Сарой стали любовницами. Да! Я взываю здесь к мнению своих читателей, которые в свое время прочтут эти записки. Я взываю к тому чувству, которое заключено в сердце всякого сына Адама. Была ли я виновницей или преступницей, если благодаря грубой ошибке занимала в мире то место, которое мне не предназначалось? Но пока Алексина вкушала радости разделенной любви, по школе поползли слухи о привязанности двух учительниц. Стало ухудшаться и здоровье Алексины: "ужасные, необъяснимые" боли пронзали ей – как можно догадаться – пах. Пришел врач и был потрясен тем, что обнаружил ("Боже! Возможно ли это?"). Он посоветовал директору удалить Алексину из школы, но сказал об этом в таких обтекаемых выражениях, что никаких действий не последовало. Итак, счастливая в любви Алексина осталась в школе. Однако чувство вины преследовало ее, и она рассказала обо всем на исповеди монсеньору Ж.-Ф. Ландрио, епископу Ла-Рошели. Этот почтенный и мудрый священнослужитель выслушал ее с сочувствием и спросил, может ли он нарушить тайну исповеди и посоветоваться со своим доктором, "истинным человеком науки".[206] И здесь история Алексины больше не зависит от затуманенной иносказательности ее мемуаров, так как Д-р Шесне опубликовал свое заключение: Является ли Алексина женщиной? У нее есть вульва, большие губы и женская уретра, независимо от своеобразного неперфорированного пениса, который может быть чудовищно разросшимся клитором. У нее есть влагалище. Правда, оно очень короткое и очень узкое. Но, в конце концов, что же это, если не влагалище? Речь идет о типично женских признаках. Да, но Алексина никогда не менструировала; вся наружная форма ее тела мужская, и мое обследование не позволило мне обнаружить матку. Ее вкусы, ее привязанности влекут ее к женщинам. По ночам она испытывает чувственные ощущения, которые заканчиваются семяизвержением... Наконец, чтобы подвести итог уже сказанному, сообщу, что я нашел на ощупь в разделенной мошонке овоидные тела и семенные канатики.[207] Шесне прекрасно знал, что он обнаружил: Алексина была гермафродитом. Возможно, медицина и признавала существование гермафродитов, но законы и общественное мнение относились к ним иначе. Нужно было сделать выбор, и овоидные тела решили дело. Начиная с XVII века медики договорились, что в случае сомнений в отношении пола индивида основную роль играет гонадный пол, а у Алексины были тестикулы. Дело и до сей поры обстоит так: современный врач назвал бы Алексину "мужским псевдогермафродитом", поскольку у нее были только яички (у "женского псевдогермафродита" есть только яичники, а у "истинного гермафродита" – и то и другое). Отказавшись от должности и любовницы, Эркюлин Аделаида Барбен вскоре стала официально именоваться Абелем. Вызвав всеобщий скандал, Абель появился на публике, после шумихи в газетах испытал кратковременную вспышку сомнительной славы и сбежал в столицу, где попытался скрыться в безвестности и начать жизнь с нуля. Здесь, в Париже, спустя несколько лет и оборвались его мемуары. Они были обнаружены рядом с постелью, на которой он умер.[208] Гениталии Чтобы понять Абеля Барбена и многих других, чья жизнь пропала или пропадает из-за неопределенности их половой принадлежности, надо узнать все о том, что делает нас мужчинами или женщинами. Тем не менее этот рассказ может быть упрощен, сведен к самому существенному. Абель не просто влюблялся в представительниц женского пола, игнорируя мужчин, не только жил с таким телом, пол которого плохо соответствовал обуревавшим его страстям, и не в том даже дело, что жизнь его текла в такие времена, когда ничто не прощалось, – подобные истории достаточно известны. Нет, его рассказ гораздо больше удивляет другим. Он о теле, которое не смогло с достаточной убедительностью выбрать один из двух путей половой идентификации. В основе своей это рассказ о половых органах. Если мы рассмотрим тело мужчины и тело женщины, то увидим в них, даже не задумываясь над этим, черты сходства и признаки, аналогичные друг другу. Сердце остается сердцем, в чьей бы груди оно ни билось. С половыми органами дело обстоит иначе. Их детали кажутся менее похожими друг на друга, чем у различных органов, которые каким-то чудодейственным образом ухитряются работать вместе. Все, что находится ниже пупка, вызывает у нас интерес именно своими различиями. Однако у анатомов иные вкусы. Сталкиваясь с разнообразием, они инстинктивно стремятся упрощать и объединять, создавать схемы, которые соединят вместе самые непохожие структуры. Эта тема – поиски гомологов – проходит через всю мою книгу. Но в данном случае нас занимает чуточку иное: поиски гомологов не между видами, которые отдалились друг от друга в процессе эволюции, а скорее между полами. Первое веское объяснение соответствию между мужскими и женскими половыми органами дал в 1543 году Андреас Везалий, основатель выдающейся анатомической школы эпохи Возрождения в Университете Падуи. Яичники, утверждал он, эквивалентны тестикулам, каждая из женских фаллопиевых труб – семявыносящему протоку, матка – мошонке, вульва – крайней плоти, а влагалище – полая трубка, считалась женским вариантом самого пениса. Таким образом, для Везалия женские половые органы были такими же, как и мужские, но просто располагались внутри тела. Эта точка зрения как будто объясняла все. Чтобы придать ей больше убедительности, он проиллюстрировал ее изображением влагалища, шейки матки и самой матки в виде мужских половых органов, пребывающих в состоянии хронической полуэрекции. Внутренние женские половые органы. Из книги Андреаса Везалия "О строении человеческого тела", 1543 (Библиотека Уэллком, Лондон). В учебниках по половому воспитанию всегда приводятся схемы мужской и женской репродуктивных систем. Окрашенные в два контрастных цвета, они выглядят как переплетения снабженных названиями трубок. Хотя на вид они кажутся малопривлекательными, по сути эти диаграммы вполне верны. Читатель, который припомнит, как выглядит схема женского репродуктивного тракта, незамедлительно поймет: в ней мало сходства с той, что изобразил Везалий. При более пристальном рассмотрении этой диаграммы, 27-го рисунка из пятой книги "О строении человеческого тела", становится ясно, что она неверна в огромном количестве деталей. Везалий изобразил влагалище в виде длинной, жесткой, стержнеобразной структуры, но оно таковым не является; у него также нет набухания на кончике, там, где помещается головка. И хотя мошонку можно разделить на две половинки (по шву – месту соединения двух эмбриональных генитальных складок), с маткой так поступить нельзя. Некоторые из сделанных Везалием ошибок были следствием простой спешки. Его диаграмма основывалась на вскрытии тела возлюбленной одного падуанского священника, останки которой были незаконно эксгумированы студентами Везалия и подверглись быстрому и довольно-таки безжалостному анатомированию. Но и в этом случае сделанные ошибки ставят в тупик: ведь Везалия обычно отличает исключительная педантичность. Невольно возникает мысль, что нарисованное им влагалище в той же степени отражает увиденное на секционном столе, как и его теорию общностей между мужчиной и женщиной.[209] В том, что такие общности – гомологи – существуют, сомнений быть не может. Проблема в том, что они совсем иные, чем те, о которых сообщал Везалий. Ошибки Везалия состоят не в том, что он нарисовал на бугорок больше или на бороздку меньше. Даже допуская, что нам трудно увидеть мир таким, каким он представлялся взору анатома XVI века, а еще труднее узнать, что ему было и что не было известно, при взгляде на рисунок Везалия возникает ощущение, что здесь все неправильно, а нечто важное попросту отсутствует. Действительно, так оно и есть. Глубокий знаток женской репродуктивной системы, он тем не менее не смог прикоснуться к самой важной ее детали. Другой анатом из Падуи, Ренальдо Колумб, тот самый, у которого возникли проблемы с дополнительным ребром, в 1559 году нашел то, что пропустил Везалий: клитор. Он назвал его "услада Венеры" и описал в возвышенных, восторженных и неточных выражениях: "Дотронься до него хотя бы мизинцем, и семя с быстротой воздуха потечет туда и сюда, при этом они будут млеть от удовольствия, даже сами того не желая... Если женщина испытывает влечение к мужчине, – продолжает он, – то клитор становится несколько тверже удлиняется до такой степени, что проявляет себя как своеобразный мужской половой член". Однако затем он помещает этот восхитительный орган внутрь матки. Вообще совершенно не ясно, был ли Колумб действительно первым в этом деле. Соперничавшие с ним анатомы обвиняли его в том, что он описал структуру, которая была известна еще грекам. Даже Колумб не смог обнаружить все, чем отличался клитор. В 1998 году, к удовольствию всех, кто и прежде подозревал, что секс есть нечто большее, нежели простое возбуждение того, что, в конце-то концов, было малюсеньким кусочком плоти, клитор в два с лишним раза увеличил свои размеры. Группа австралийских анатомов (возглавляемая, что, наверное, неудивительно, женщиной), работая на свежих трупах молодых женщин, а не на законсервированных трупах старушек, являющихся обычной поживой студентов-медиков, установила, что клитор – это не просто малюсенький отросток из учебника анатомии и сексологическая догма, а большая разветвленная структура, которая окружает уретру и проникает в стенку влагалища. Какое, казалось бы, замечательное открытие! Прямо-таки воплощение вагинального оргазма Зигмунда Фрейда, который столько лет подвергался насмешкам. В Англии газеты восторженно приветствовали новое открытие и выражали удивление, как такая замечательная вещь могла столько лет оставаться неизвестной. Конечно, это было не так: о ней знали и раньше. Новый улучшенный клитор – всего-навсего давний и хорошо описанный объект, который несколько изменил местоположение и подвергся переоценке. Эта структура была прежде известна под названием вестибулярных луковиц, представлявших собой два непонятных разрастания губчатой ткани, глубоко пронизанной кровеносными сосудами. Голландский анатом XVII века Ян Сваммердам думал, что это части клитора, но величайший из всех исследователей половых органов, Георг Людвиг Кобельт (автор книги "Мужские и женские органы сексуального возбуждения у человека и некоторых млекопитающих", 1844), внимательно изучив их, пришел к выводу – для равновесия – что они таковыми не являются. Возник вопрос: имеют ли эти луковицы столь же богатую иннервацию, как головка пениса и головка клитора. И если да, тогда, возможно, следует их именовать частями клитора. Нервы там действительно есть, но до сих пор неясно, какого рода ощущения они передают. А это-то и есть главное: разросшийся клитор, лишенный ощущений, вероятно, вообще недостоин своего названия.[210] Клитор и вестибулярные луковицы. Из книги Георга Людвига Кобельта "Мужские и женские органы сексуального возбуждения у человека и некоторых млекопитающих", 1844 (Библиотека Уэллком, Лондон). Однако каким бы он ни был – большим или маленьким, представление Колумба о клиторе как "своеобразном мужском половом члене" в принципе было правильным, хотя и несколько фаллоцентричным. Оно помогало решить проблему гомологий (клитор = пенис), но только отчасти: соответствие остальных органов было по-прежнему неясным. Каков в таком случае женский эквивалент мошонки? И где у мужчин влагалище? Лишь в XIX веке эмбриологи, исследуя развитие органов у зародыша, окончательно установили, что гомологично и что уникально в женских и мужских гениталиях. К двадцать восьмому дню после зачатия эмбрион, длиной примерно в полсантиметра, обладает четырьмя небольшими почками конечностей и хвостом. Именно в это время появляются первые наружные признаки пола: ничего особенного, просто небольшое возвышение между нижними почками конечностей и чуть повыше хвоста. Это возвышение – половой бугорок – вскоре оказывается в окружении двух небольших комплектов складок – один внутри другого.[211] Вместе половой бугорок и складки образуют в дальнейшем все разнообразие наружных половых органов. (Внутренние половые органы – все эти трубы и протоки – имеют иное происхождение.) Половой бугорок по виду напоминает бледный миниатюрный росток спаржи, вытянувшийся внутри более яркой, телесного цвета борозды. По мере роста становится очевидным его предназначение: это фаллос, но какой именно – пенис или клитор, пока неясно. Внутренний набор складок удлиняется синхронно росту бугорка и образует под ним своего рода щель, а обе эти структуры – бугорок и мягкая щель – помещаются внутри наружных складок, которые, разрастаясь, формируют вокруг защитный валик. Это нулевой цикл создания гендера: описанные выше стадии формирования являются общими как для мужчин, так и для женщин. Различия проявляются лишь на шестьдесят третий день, когда зародыш достигает в длину нескольких сантиметров, а его хвост превращается в совершенный обрубок, как у терьера. Если зародыш мужского пола, то бугорок удлиняется еще больше, а находящаяся под ним бороздка срастается и образует трубку – мочеполовой канал, путепровод для мочи и спермы. Чуть ниже его более крупные наружные складки также срастаются, создавая мешок – мошонку, который до поры до времени остается пустым. Яичники находятся в глубине абдоминальной стенки и остаются там до сто шестидесятого дня, когда они начинают мигрировать вниз, в мошонку. Если зародыш женского пола, половой бугорок сохраняет свои изначальные размеры, но стенки находящейся под ним щели разрастаются и углубляются, превращаясь в малые губы. Наружные складки разбухают, но не срастаются, как у мужчин, а становятся большими половыми губами. Они продолжают расти, так что маленький женский половой бугорок, который теперь уместно называть клитором, делается едва заметным. Но как обстоят дела с влагалищем? Эквивалента этому органу у мужчин нет. Часть влагалища образуется из тех же складок, что и малые половые губы, тогда как внутренние элементы ведут свое происхождение от набора протоков, которые формируют также остальные половые органы у женщин, но не у мужчин. Аналогии теперь ясны: пенис и клитор; мошонка и большие губы; уретра и малые губы; и влагалище, которое имеется только у женщин. Благодаря этим сопоставлениям можно представить себе, что случилось в Сен-Жан-д'Анжели в апреле 1838 года. Они расскажут о том, как Абель, или урожденная Алексина Барбен, мог обладать одновременно пенисом, хотя и небольшим, и влагалищем, хотя и очень неглубоким. Будучи плодом, он как будто бы прошел часть пути по направлению к мужской половой принадлежности, а затем, не завершив его, остановился. Или же пропустил молекулярный указатель на развилке дорог и не свернул в нужную сторону. Пятьдесят на пятьдесят Становиться женщиной – это значит катиться по главной дороге, прямой и широкой. Сворачивать в сторону – удел мужского зародыша, и случись ему сбиться с пути, он снова оказывается на тракте, ведущем к женскому началу. Первый придорожный столб – самый известный из всех: это Y-хромосома. Она была открыта в 1956 году, а спустя три года признана центральным органом контроля половой принадлежности у человека.[212] В человеческом организме все хромосомы составляют пары, согласованные по размерам, а также по числу и типам содержащихся в них генов. Так же обстоит дело и с половыми хромосомами, хотя в данном случае подбор пары происходит сложнее: у женщин ее образуют две X-хромосомы, а у мужчин пара состоит из X-хромосомы и Y-хромосомы. (О здоровых мужчинах и женщинах говорят, что их хромосомный набор: XX или XY соответственно.) X- и Y-хромосомы по внешним признакам плохо подходят друг к другу: первая из них большая, вторая маленькая. Они напоминают одну из тех с виду странных пар – крупная почтенная женщина и мелкий щеголеватый мужчина, которых иногда можно встретить среди профессиональных танцоров аргентинского танго. Это действительно удачное сравнение, так как, несмотря на кажущееся несоответствие, оба партнера прекрасно работают вместе. При определении пола, как и в танго, Y командует, а X подчиняется. Несомненным доказательством ведущей роли Y в детерминации пола служит тот факт, что действие этой хромосомы доминантно по отношению к X-хромосоме. Что доказывают мужчины, которые обладают Y-хромосомой, но также имеют аномально большое количество X-хромосом (то есть являются по генетическому составу XXY, XXXY или даже XXXXY). Такие люди – несомненные мужчины (и они имеют абсолютно нормальные половые органы), подтверждая тем самым, что любое число X-хромосом оказывается бессильным заблокировать действие единственной хромосомы Y, формирующей особь мужского пола. Правда, в пубертатном периоде действие Y-хромосомы слегка ослабевает, и у таких юношей часто развиваются грудные железы и неопределенная сексуальная ориентация.[213] Но в утробе матери все решается однозначно: присутствие Y-хромосомы означает, что плод безоговорочно выбирает путь к маскулинности. Доминантное поведение Y-хромосомы не тот случай, который дает повод для радости поборникам мужского шовинизма (или для огорчения неукротимым феминисткам). Термин "доминантность" относится всего лишь к молекулярным закономерностям, задействованным в процессе образования пола, а не к соотношению тех или иных качеств у мужчин и женщин. Доминирование Y-хромосомы – это, вероятно, всего лишь случайный эпизод в истории видов. У птиц также есть половые хромосомы, но они эволюционировали совершенно независимо от таковых у млекопитающих и называются W и Z вместо X и Y. Эти птичьи половые хромосомы, похоже, действуют так же, как и у млекопитающих, за исключением того, что в данном случае несовпадающая пара хромосом (WZ) характеризует самок, а совпадающая (ZZ) – самцов. При этом у птиц хромосома, уникальная для самок (W), оказывается доминирующей по отношению к той, что имеется также и у самцов (Z). Так могло произойти и с млекопитающими, но, по-видимому, по воле случая не произошло. Поиски источника способностей Y-хромосомы контролировать процесс образования пола заняли тридцать четыре года. По размерам Y может быть карликом среди хромосом, но все равно она имеет в длину сорок с лишним миллионов пар оснований. Сократить эту обширную протяженность ДНК до неких поддающихся объяснению размеров помогла небольшая и необычная группа людей, как будто не подчиняющихся диктату половых хромосом. Это были мужчины, у которых странным образом отсутствовала Y-хромосома. Такой диагноз был им поставлен в процессе лечения от азооспремии (бесплодия, вызванного неподвижностью спермиев). Гермафродитами они не были, поскольку у них имелись яички, прекрасно сформированные мужские половые органы – и только они. Генетики называют таких мужчин реверсированными женщинами. Подобная терминология сама себе явно противоречит, но так же обстоит дело и с самими этими людьми, которые являются по генетической конституции женщинами, а по физическим проявлениям – мужчинами. Тщательное исследование половых хромосом у реверсированных женщин показало, однако, что противоречие тут скорее кажущееся, нежели реальное. У каждого из таких индивидов в одну из X-хромосом был аномально включен кусочек Y-хромосомы. При отсутствии всей Y-хромосомы них каким-то образом оказался тот ее участок, который имел решающее значение в определении пола. В 1990 году на этом участке был обнаружен ген, кодирующий транскрипционный фактор, чего и следовало ожидать от гена, который должен напрямую контролировать по крайней мере некоторые из многих других генов, в совокупности определяющих различия между полами. Этот ген получил название "определяющая пол область Y-хромосомы" (Sex-determining region on Y, или SRY). Само название любопытно: не определяющий пол ген, а – область. В нем звучат нотки колебания, уклончивости и осторожности. Весьма желательная осторожность, поскольку история поисков особой роли Y-хромосомы – это в значительной степени история потраченных впустую усилий. До SRY был другой ген – ZFY, а перед ним – молекула под названием антиген H-Y, но в обоих случаях исследователи шли по ложному следу. Подробный рассказ о том, как это выяснилось, был бы слишком долгим и запутанным. Достаточно сказать, что окончательная дискредитация вышеупомянутых молекул как детерминаторов пола служит прекрасным примером развития процесса научного познания. Сотни работ были уже опубликованы по поводу этих молекул (в особенности об антигене H-Y), множество научных судеб зависело от них, но когда контраргументы стали действительно изобличающими, все отошло в сторону и поиски начались снова. Что до SRY, это был несомненно достойный кандидат. Не исключалась, однако, возможность, что существует еще один ген, расположенный где-то поблизости, но пока что скрытый от взоров, который может действительно оказаться главным. К счастью, этого не случилось. На сегодня существует множество разного рода доказательств, демонтирующих, что SRY и есть главный регулятор тендера. Вот одно из них: наряду с явными реверсированными женщинами (мужчины XX) существуют и столь же очевидные реверсированные мужчины (женщины XY). И подобно тому как у мужчин XX имеется действующая копия SRY в том месте где ее быть не должно, так и у многих женщин XY, как было недавно обнаружено, нет работающей копии SRY там, где она должна присутствовать. Один ген – SRY, два нормальных его состояния (присутствие на Y-хромосоме, отсутствие на X-хромосоме), два аномальных состояния (отсутствие на Y-хромосоме, присутствие на X-хромосоме) – и в результате полная инверсия всего, что связано с полом. Это столь прекрасная демонстрация работы гена, что лучшего нельзя и желать.[214] Если Возможно, SRY активизирует какие-то важные для развития маскулинности гены, а возможно, наоборот, лишает активности другие, необходимые для развития женского начала.[215] Может быть, имеет место и то и другое. Свисающие половые органы, волосатая грудь и взрослый мозг, чрезмерно озабоченный сексуальными проблемами, – все это, наверное, и есть последствия обладания SRY, но весьма отдаленные. Основное, что делает SRY, – это контролирует судьбу двух небольших органов у зародыша. Мы знаем об этом благодаря неким экспериментам, которые проводились в вишистской Франции. Плод кролика – сама хрупкость. Чтобы выполнить на нем хирургическую операцию, после которой он бы выжил, нужна рука настоящего мастера. Таким человеком был французский биолог Александр Жост. В середине 1940-х годов он начал серию экспериментов, в ходе которых вскрывал матку беременной самки, удалял гонады у ее неродившихся крольчат, а затем зашивал зародышей обратно. Если мать и плоды выживали, что в начале экспериментов удавалось далеко не всегда, он убивал их спустя десять дней, анатомировал и изучал у плодов половые органы. Жост обнаружил, что у кроликов-кастратов не произошло формирования мужских половых органов. Лишенные семявыносящего протока, предстательной железы, мошонки и пениса, они вместо этого обладали яйцеводами (фаллопиевыми трубами), маткой и влагалищем. Возможно, это был жестокий эксперимент (впрочем, ничуть не хуже кастрирования любого домашнего животного), но в равной степени и о многом говорящий: он показывал, что плод мужского пола нуждается в своих гонадах.[216] Или, по крайней мере, в своих клетках Лейдига. Эти клетки, находящиеся внутри гонад, продуцируют гормоны, которые формируют у млекопитающих принадлежность к мужскому полу. Без SRY эти и другие клетки мужских гонад не могут существовать. Один из гормонов – собственно тестостерон, стероид, производимый клетками Лейдига из довольно-таки опасных молекул – холестерина. Плод мужского пола начинает производить тестостерон в больших количествах примерно на пятидесятый день, а пик выброса наблюдается около сто пятидесятого дня. Для выполнения этой работы требуется четыре фермента, каждый из которых служит одновременно дорожным указателем и может, если что-то идет не так, вернуть плод XY назад, на ту дорогу, где становятся женщинами. В генах, кодирующих три таких фермента, обнаружены мутации.[217] Они не вызывают полной перемены пола, но производят нечто среднее: гермафродита. Или, точнее, мужского псевдогермафродита, поскольку яички у него присутствуют, хотя и дисфункциональные. Биохимия формирования маскулинности пугает своей сложностью. Если, как сказал Киплинг, на пути становления мужчины стоит неспособность "владеть собой среди толпы сметенной..." (и так далее), то еще вернее выполняют эту роль мутации синтеза тестостерона. К такому же итогу приведут мутации, вызывающие нарушения дифференциации и роста клеток Лейдига. А также мутации рецептора тестостерона. Тестостерон проникает в клетки растущего плода мужского пола и связывается с белковым рецептором. Гормон и рецептор затем проникают в ядра клеток, где они оба связываются с ДНК и включают гены, необходимые для того, чтобы сделать мужчину мужчиной. Во многих семьях обнаружены десятки повреждающих рецептор мутаций, что обычно приводит к появлению на свет новорожденной девочки – по крайней мере во внешних проявлениях. Если бы акушерка попыталась найти у нее шейку матки и саму матку, ей бы это не удалось. Но нарушение обычно выявляется в пубертате, когда эти несомненные с виду девочки не способны к началу менструирования. Такие девочки, как часто говорят, необычайно женственны – по крайней мере внешне. Лишенные рецептора тестостерона, они подвергаются еще меньшему влиянию маскулинизирующих гормонов, чем истинные женщины, которые до некоторой степени это воздействие испытывают.[218] Одна явно маскулинная черта – их рост: во взрослом состоянии они становятся очень высокими.[219] Это обстоятельство также наводит на мысль о том, что различия между мужчинами и женщинами есть следствие иных, чем тестостерон, механизмов (впрочем, каких именно, до сих пор неясно). Сочетание женственного облика с мужским ростом приводит к тому, что женщины без тестостероновых рецепторов обладают исключительной привлекательностью. В 1950-х годах, как минимум, одна француженка с таким дефектом зарабатывала на жизнь демонстрацией моделей одежды, а парочка однояйцевых близнецов из Канады с аналогичными нарушениями работали стюардессами в авиакомпании.[220] Многие мужские псевдогермафродиты, однако, не характеризуются полной феминизацией к моменту рождения. Они обладают, как говорят врачи, "неопределенными" гениталиями: фаллосом, который слишком велик для клитора, но мал для пениса, или отверстием уретры, расположенным не на кончике пениса, а где-нибудь у его основания, хотя ясно, что влагалище вообще отсутствует. Как бы то ни было, практически у всех гениталии остаются в дальнейшем такими, какими они были при рождении, если, конечно, не прибегать к хирургическому вмешательству. Правда, у некоторых, крайне малочисленных, индивидов в период созревания происходит трансформация в их истинный генетический пол. Это вновь возвращает нас к истории Алексины / Абеля Барбена, чей увеличивающийся фаллос и постоянный рост волос на лице стали причиной описанных выше болей и душевного смятения. Люди, подобные Алексине, всегда были и есть среди нас. Амбруаз Паре и Монтень оба встречались с Мари Жерар, крестьянкой из деревни Витри-ле-Франсуа, которая, гонясь однажды за свиньей, вдруг обнаружила у себя пенис. По ее утверждению, он просто вывалился из-за тех усилий, которые она делала, прыгая по хлеву. Более вероятно, что рост фаллоса происходил постепенно и что его/ее объяснение было сочтено просто наиболее подходящим. После случившегося Мари взяла себе новое имя: Жермен. Мужской псевдогермафродитизм. Эркюлина Барбен (1838-1868). Из книги Э. Гужона "Изучение случая несовершенного двуполого гермафродитизма у человека" (Британская библиотека). Случаи с Алексиной / Абелем и Мари / Жерменом были единичными.[221] Мы не знаем о существовании каких-либо родственников или потомков у того или другого мужчины, которые демонстрировали бы сходные симптомы. Но феномен "девочек, становящихся мужчинами", известен в некоторых отдаленных регионах мира. До недавнего времени жители деревни Салинас (население 4300 человек), расположенной в труднодоступной части Доминиканской Республики, ошибочно определяли пол у одного из девяноста порожденных мальчиков, считая его девочкой, которая затем изменяла пол в пубертатном периоде. Такие случаи были настолько обычными, что деревенские жители придумали для них специальное название: геведоче (guevedoche), или "пенис в двенадцать лет". По другую сторону земного шара, в восточных горных районах Папуа – Новой Гвинеи, обнаружилось нечто похожее. Там в племени самбия, занимающемся охотой и садоводством, людей, изменивших пол, именуют "куолу-аатмуол" (kwolu-aatmwol) – "превратившийся в мужское существо", или на грубо прямолинейном языке пиджин – "мужчина-превращенец". Именно благодаря геведоче прояснились причины этих явлений: у всех геведоче отсутствует фермент под названием 5-α-редуктаза. В большинстве частей тела тестостерон транспортируется прямо в клетки, где он включает гены, определяющие мужской пол. Но в гениталиях плодов мужского пола большая его часть вначале трансформируется в более мощную форму дигидрокситестостерона, или ДГТ. Именно это и делает 5-α-редуктаза: любая мутация, поражающая этот фермент, приводит к отсутствию ДГТ и к нарушениям роста наружных половых органов. ДГТ необходим для плода, но в отрочестве работу выполняет сам тестостерон, а поскольку у геведоче его много, они начинают маскулинизироваться. Все эти люди ведут свою родословную от одной женщины по имени Альтаграсия Караско. Возможно, что дефектный фермент – ее наследие. Поразительно, что дефект того же самого фермента обнаружен и у самбийских куолу-аатмуол. И хотя об этом мы не можем судить наверняка, тот же фермент, по всей вероятности, отсутствовал и у Алексины / Абеля, что привело к запуску всей цепи описанных выше событий.[222] Гиены Когда я говорил, что дорога, ведущая к формированию женской особи, прямая и широкая, я имел в виду, что, по крайней мере, у людей существует немного мутаций, которые приводят к женскому псевдогермафродитизму, то есть к маскулинизации наружных половых органов у ребенка с яичниками девочки. Но все же они имеются. Одна из них красноречивее других говорит о деликатном балансе формирования полов во внутриутробном периоде. Эта мутация была обнаружена всего лишь несколько лет назад у молодой японки, ожидавшей своего первенца. Беременность протекала без осложнений, по крайней мере поначалу. Но в третьем триместре появились первые признаки того, что не все идет гладко: у молодой женщины стала расти борода. После консультаций с эндокринологами была легко определена причина: вместо обычных при беременности эстрогенов в ее крови содержались абсурдно высокие концентрации тестостерона, что с неизбежностью сказалось и на ребенке. Хотя это была явная девочка (и по результатам генетического анализа тоже), при рождении у нее обнаружился невероятно разросшийся клитор – длиной до двух сантиметров – и частично сросшиеся половые губы – явные признаки маскулинизации. Во всем была виновата плацента. Во время беременности она в изобилии продуцирует тестостерон. Обычно он не наносит ущерба плоду, так как тестостерон быстро превращается в эстрадиол и эстрон с помощью фермента, называемого ароматазой, которым особенно богата плацента. Именно этот фермент и оказался поврежденным. Мутация носит рецессивный характер: у каждого из родителей имеется по одной дефектной копии гена, которые не приносят никаких нарушений. В дальнейшем две дефектные копии передаются от обоих родителей ребенку – и плаценте, часть которой служит продолжением плода и имеет свой собственный генотип. В результате появляется ребенок, который при всей своей невинности становится для матери чем-то вроде гормонального троянского коня и вызывает в ее организме хаос задолго до своего рождения.[223] Вслед за SRY ароматаза – вероятно, единственный самый важный регулятор пола у человека. Она находится на перекрестке путей по производству тестостерона и эстрогена и регулирует транспортные потоки. Девочки, у которых отсутствует ароматаза, не только рождаются с маскулинизированными наружными половыми органами, но по мере взросления становятся очень волосатыми, вплоть до роста бороды, и характеризуются увеличением яичников. С другой стороны, отсутствие фермента у мальчиков вообще проходит практически без последствий – хотя, как уже обсуждалось в предыдущей главе, при дефиците эстрогена они растут еще долго после того, как уже должны были бы остановиться. Однако и мальчикам не удается так легко уйти от опасности. Далеко не все мутации ароматазы вызывают повреждение гена. Некоторые идут по пути приобретения функции, что вызывает гиперактивность фермента и, следовательно, избыток эстрогена и отсутствие тестостерона. Девочки с такими мутациями характеризуются преждевременным развитием и становятся невысокими женщинами с большими грудями. Мальчики с такими мутациями тоже невысокие и, что более неприятно, тоже имеют развитые груди. Мутации ароматазы – не единственная причина развития грудных желез у мальчиков и мужчин: до 60 процентов подростков и юношей имеют заметно набухшие соски, которые, однако, почти всегда исчезают – по крайней мере с возрастом, когда эстрогены, продуцируемые жировой тканью, приводят все в норму.[224] Люди с выраженными мутациями половой идентичности часто бесплодны. Поверхностные нарушения (например, "неопределенные" гениталии) могут иногда корректироваться хирургическим путем, хотя вопрос о том, кто именно должен подвергаться такой операции и в каком возрасте ее следует делать, вызывает все больше споров. Все мутации, приводящие к нарушению половой идентичности, о которых я здесь написал, имеют свои аналоги у других млекопитающих. Животные, которые не принадлежат ни к тому, ни к другому полу, должны редко размножаться. Можно подумать, что такие мутации всегда ведут к эволюционному тупику. Всегда ли? Обобщать трудно, так как естественный отбор настолько причудлив и так охотно вступает в действие при наличии любой генетической вариации, что в процессе эволюции могут произойти самые невероятные вещи. Пятнистые гиены – малосимпатичные создания. У них неуклюже тела, гогочущие крики и отвратительные привычки. Неважно, что им нравится поедать падаль; они еще мочатся в воду, которую пьют, и рады вываляться в собственной рвоте. Но еще любопытнее, что их сообщество состоит из могучих самок и хиленьких самцов. И у самцов и у самок есть своя собственная четкая иерархическая структура, при которой самая низшая по рангу самка стоит выше наиболее доминирующего самца. Когда клан гиен занят своим грязным делом у туши антилопы гну, самцы должны есть быстро, потому что самки – гораздо более крупные – неизменно прогоняют их прочь. Размеры тела и склонность к ничем не провоцируемой агрессии делают самок гиен, как это ни парадоксально, практически самцами. Наши сомнения понятны, но давайте посмотрим на гениталии этих животных. Самки пятнистых гиен обладают такими наружными половыми органами, которых нет больше ни у кого из млекопитающих. Наиболее заметной их чертой является клитор, такой же величины, как пенис у самцов, внутри которого проходит мочеполовой тракт с отверстием, расположенным на самой верхушке. Во время демонстраций доминантного поведения он способен на короткое время выпрямляться. Под ним, там, где должно находиться влагалище, располагается структура, удивительно напоминающая мошонку, но состоящая из жировой подушки, а не из тестикул. Из-за отсутствия влагалища самки пятнистых гиен спариваются и рожают через клитор. Это очень болезненный процесс. Когда пятнистые гиены впервые рожают, их протоки в клиторе настолько узки, что роды длятся часами; за это время более 60 процентов щенков погибает от удушья и около 9 процентов матерей умирает. Хотя Аристотель не был сторонником подобного мнения, представление о том, что пятнистые гиены – истинные гермафродиты, просуществовало вплоть до XIX столетия. На самом деле это не так: по внутреннему строению самки и самцы гиен сильно различаются – у одних имеются яичники, У других тестикулы, и все. Поскольку самки полосатых и коричневых гиен (ближайших ныне живущих родственников пятнистых гиен) обладают типичными для млекопитающих наружными половыми органами, пятнистые гиены должны считаться, в полном смысле этого слова, женскими псевдогермафродитами, причем такими, у которых патология стала нормой. Была изучена плацента пятнистых гиен, и выяснилось, что в ней также продуцируется большое количество тестостерона и – о чем можно было бы и так догадаться! – имеется естественный дефицит ароматазы. Поскольку ген ароматазы у гиен до сей поры не клонирован, мы пока не знаем, насколько он отличается у пятнистых гиен от такового у их полосатых и коричневых родичей. Но вполне вероятно, что где-то в процессе эволюции пятнистые гиены приобрели ген ароматазы с мутацией, которая была похожа на ту, что выявили у японской девочки. Это вовсе не обязательно: мутация могла произойти в другом гене, контролирующем ароматазу, но каковы бы ни были причины, концентрация ароматазы почти наверняка объясняет, хотя бы и отчасти, почему детеныши женского пола у пятнистых гиен рождаются с мужеподобными гениталиями. Какой эффект тестостерон оказывает на беременных мамаш, у гиен понять трудно: они и в лучшие времена остаются покрытыми шерстью.[225] Объект желания В "Пире" Платон вкладывает в уста Аристофана речь, объясняющую природу полового влечения. Некогда, говорит Аристофан, описывая мифические прошлые времена, жили существа трех родов: мужского, женского и андрогинного. Существа эти были не такими, как сейчас, а состояли из сросшихся пар: мужчины с мужчиной, женщины с женщиной, а андрогины, которых было большинство, состояли из мужчины и женщины. Это описание древних пра-людей делает их удивительно похожими на сросшихся близнецов типа цефалоторакоилеопагус. Они могли перекатываться по земле с помощью своих восьми конечностей и были беспокойными, энергичными и гордыми. Зевс не знал, что с ними делать, и решил разрезать пополам. С тех пор каждый человек желает воссоединиться со своей второй половиной. Это объясняет, почему некоторых из нас привлекают лица того же пола, но большинство стремится к противоположному. Причины различной сексуальной ориентации настолько непонятны, что объяснение Аристофана ничуть не хуже большинства сегодняшних. Возможно, именно поэтому немало людей противятся поискам биологических основ сексуальной ориентации. Но если мы не относим себя к картезианским дуалистам (а ни один из биологов, по определению, таковым не является), тогда различия между телом и разумом определяются глубиной наших познаний – ибо о телесном мы знаем много, а о духовном – почти ничего. Нет сомнений, что сложная цепь молекулярных событий, управляющих мотивами желаний, формированием наших гениталий, также влияет и на выбор объекта желания – кому мы отдаем предпочтение и посвящаем свое сердце. Случай Алексины / Абеля поразителен еще и потому, что, воспитываясь как девочка, она влюблялась в девочек. Иными словами, ее привязанности вполне соответствовали ее полу – истинному, скрытому полу, а не внешнему, очевидному. Это выглядит вполне разумным, но многие врачи и антропологи думают иначе. Для них сексуальная ориентация обусловлена социальными влияниями, тем, как воспитывается ребенок, в особенности на ранних этапах жизни. Согласно подобной точке зрения, Алексина / Абель, выросшая как девочка среди девочек, должна была, повзрослев, влюбляться в мужчин. Врачи восприняли эту идею из исследований сексологов 1950-х годов, антропологи – из работ Франца Боаса и Маргарет Мид. Такие социально-конструктивистские представления о гендере, каков бы ни был их источник, быстро теряют свою убедительность под давлением молекулярно-генетических исследований сексуального поведения. Уже в 1979 году изучение сексуальных отношений у геведоче из Доминиканской Республики должно было бы стать убедительным доказательством того, что гормоны тоже кое-что значат. Подобно Алексине / Абелю, геведоче традиционно воспитываются как девочки и тем не менее практически без вариантов, взрослея, выбирают принадлежность к мужскому полу. У них, возможно, имеется недостаточно ДГТ для формирования первосортных мужских наружных половых органов, но количество тестостерона, получаемое ими либо в утробе матери, либо в пубертатном периоде, достаточно велико, чтобы они чувствовали себя мужчинами, которые хотят любить женщин и жениться на них. Конечно, для них это нелегко. В юности они страдают от комплекса неуверенности в себе и боязни, что женщины будут высмеивать их из-за формы наружных гениталий. Само прозвище геведоче, придуманное жителями деревни Салинас, звучит обидно и только. Для куолу-аатмуол из Папуа – Новой Гвинеи дела обстоят гораздо хуже. Там лишь меньшинство мужских псевдогермафродитов ошибочно принимают за девочек, остальные считаются мальчиками, хотя и несколько неполноценными. Чтобы стать мужчинами, мальчики племени самбия проходят через сложный путь секретных ритуалов, составляющих обряд инициации. Этих ритуалов шесть, и, как и во многих других культурах Новой Гвинеи, они носят откровенно гомоэротический характер: проходящие обряд юноши должны заниматься оральным сексом со старшими мужчинами, чтобы, согласно верованиям племени самбия, приобщиться к источнику будущего семени. По западным представлениям, самбийцы смешивают культурные и биологические аспекты половых отношений, однако мальчики, прошедшие через подобные гомоэротические ритуалы, в большинстве своем становятся гетеросексуальными женатыми мужчинами. Однако у куолу-аатмуол иная судьба. Их вроде бы допускают к прохождению обряда, но лишь к самым низшим его ступеням: они могут орально возбуждать старших мужчин, но сами не становятся объектом орального секса – что вполне понятно, так как их наружные половые органы едва ли это позволяют. И так, хотя они продолжают взрослеть и телом и душой, в поздней юности они остаются в стороне от жизни сообщества и до конца своих дней пребывают в сумеречном мире не мальчиков, но и не мужчин.[226] Глава VIII Хрупкий пузырек [о коже] Глазнокожный альбинизм II типа. Мужчина зулус, провинция Наталь. Из книги Карла Пирсона и др. "Монография об альбинизме у человека", 1913 (Библиотека Уэллком, Лондон). С 1758 года наш вид имеет лестное, хотя и не всегда справедливое, название Homo sapiens – человек разумный. По крайней мере, именно так назвал его шведский натуралист Карл Линней в десятом издании своей "Системы природы" – труде, по сей день считающемся для специалистов по таксономии первейшим, авторитетнейшим источником наименований, которые они дают всем земным созданиям. Однако с названием человека едва не произошло по-другому. В тексте Линнея, непосредственно прилегающем к термину "разумный", есть другое название, явный синоним того, которым сейчас пользуются, но при этом такой, который нигде не объясняется: Homo diurnus – человек дня. Это название, по-видимому, имело для Линнея особый смысл. Из его дневников явствует, что он на протяжении почти всей жизни колебался между двумя терминами sapiens или diurnus и лишь в десятом издании твердо поставил последний на второе место. В этой связи представление Линнея о том, что дневной образ жизни говорит о каких-то особых свойствах нашего вида, кажется загадкой. Мы действительно любим дневной свет, но такими же качествами обладают и многие другие существа. И лишь когда мы начинаем с трудом пробиваться через готический шрифт и до предела сжатую латынь линнеевского текста, мы находим объяснение его дневным мечтам. Линней, крестный отец человечества, верил, что мы не одиноки. Задолго до того, как палеонтологи извлекли из ущелий Серенгети кости наших вымерших кузенов – гоминид, Линней считал, что отдаленные части Земли заселены другим видом людей. При этом он не имел в виду тех людей, которые жили в Азии, Африке или Новом Свете: они с очевидностью принадлежали к тому же виду, что и он сам. Он думал о чем-то гораздо более экзотическом: о разновидности скрюченных людей с короткими курчавыми волосами, примерно как у африканцев, но только светлыми, с кожей белой, как мел, и с раскосыми глазами золотистого цвета. Это были сумеречные создания, обитавшие в пещерах. Они плохо видели днем и хорошо – ночью, поэтому в темноте выходили из укрытий и грабили фермы своих более умных сородичей. Они были древними обитателями Земли и, возможно, правили миром до Человека, но теперь исчезали. Этот вид, говорил Линней, был "порождением тьмы, превратившим день в ночь и ночь в день, и, по-видимому, нашим ближайшим родственником". Правда, сам ученый никогда не видел ни одного его представителя, но разве Плиний и Птоломей не писали о лейцетопах? И разве их не видели совсем недавно, в том числе и его собственные студенты, в Эфиопии, на Яве, на Тернатских островах или в Малакке на горе Офир? Все сообщения казались яркими и точными: на Цейлоне их называли какрелатами, в Амбоине – какурлаками, от голландского слова "таракан", и повсюду их презирали. Этого для Линнея было достаточно, и, верный своему инстинкту классификатора, он дал им название Homo troglodytes – Человек пещерный, а рядом написал "Homo nocturnes" – Человек ночной. О чем думал Линней? Основатель современной биологической классификации, он стоит вторым в пантеоне естествоиспытателей, уступая только Дарвину. Но никто сегодня не читает "Систему природы", а тем более другие его многочисленные труды, и мы забываем о том, что его мышление было в равной мере сродни как средневековой мистике, так и науке эпохи Просвещения. Линней был весьма легковерным. Он верил, что ласточки зимуют на дне озер, что если спину щенка потереть водкой, он вырастет карликом и что Лапландия – родина Furia infernalis – адской фурии, которая летает по воздуху без помощи крыльев и нападает на людей и домашний скот, насмерть забивая их. Это последнее описание носило явно фантастический характер даже на взгляд современников Линнея. С Homo troglodytes дело обстояло иначе. Уже в 1750-х годах было известно, что, по крайней мере в Африке, имеются создания, похожие на человека. В конце концов, Эдвард Тайсон вскрывал своего "пигмея", или шимпанзе, за пятьдесят лет до того. Еще одно подобное создание – получеловек-полуобезьяна (вопрос этот оставался весьма запутанным), – как полагали, обитало на Малайском архипелаге. Голландский натуралист Якоб Бонтиус изобразил как раз такого "урангутанга" в своей "Естественной истории Восточной Индии" (1658). Оранг Бонтиуса вполне похож на человека, разве что волосатого. Это самка, совершенно голая, но с весьма привлекательным лицом. Столетие спустя Линней позаимствовал гравюру, переименовав особь в Homo troglodytes. Homo troglodytes Линнея или оранг Бонтиуса. Из книги Карла Пирсона и др. "Монография об альбинизме у человека", 1913 (Библиотека Уэллком, Лондон). Сам Бонтиус мало что знал о своем оранге (хотя он справедливо подверг сомнению представления малайцев о том, что оранги – потомки малайских женщин и местных обезьян), поэтому Линней использовал образ для иллюстрации древних традиционных суждений, свидетельствовавших о существовании изолированной и таинственной расы неестественно белых, золотистоглазых, избегавших дневного света людей. Именно эти характеристики, а не прочие путаные сведения, говорят о том, что есть Homo troglodytes.[227] Если забыть о волосах на теле и пещерном образе жизни, станет ясно, что линнеевский ночной человек – вполне обычный альбинос. Женевьева Линней был не единственным естествоиспытателем XVIII века, питавшим интерес к альбиносам. Ими интересовался и Бюффон – французский соперник Линнея, которому, в отличие от последнего, действительно удалось лицезреть одного альбиноса. В своей "Естественной истории" он пишет о встрече с девушкой по имени Женевьева. Восемнадцати лет от роду, она была уроженкой Доминики, дочерью рабов, перевезенных туда с Золотого Берега, и в момент встречи с ученым находилась в услужении у богатой парижанки. Бюффон тщательно обследовал ее. Рост 151 сантиметр, раскосые глаза серого цвета, имеющие вокруг хрусталика легкий оранжевый окрас, белая, как мел, кожа. И все же, по его словам, черты лица у нее были абсолютно такими же, как у негритянки – темнокожей африканской женщины. Верно, что уши у нее были расположены необычно высоко, но при этом сильно отличались от ушей блафардов – альбиносов Дарьенского залива, у которых они, говорят, были небольшими и как бы прозрачными. Бюффон измерял у нее конечности, голову, ступни, волосы; он посвятил целый абзац ее грудям, отметил, что она девственница, и с особым интересом подчеркнул ее способность краснеть. Глазнокожный альбинизм II типа. Женевьева. Из книги Жоржа Леклерка Бюффона "Естественная история: всеобщая и частная", 1777 (Библиотека Уэллком, Лондон). Что заставило Женевьеву сделаться белой? Бюффон был уверен, что Homo troglodytes Линнея – всего лишь человекообразная обезьяна. Что касается блафардов, какурлаков и чакрелатов, то это были просто описания аномально депигментированных людей, живущих среди своих же, но темнокожих сородичей. Как ему говорили, один ребенок из десяти, рождающихся на Карибских островах, является альбиносом. Родители Женевьевы были темнокожими, так же как ее братья и сестры. Какова бы ни была причина белизны девушки, ее нельзя было считать ни заразной, ни представляющей особую расу. Хотя Бюффону и не удалось решить проблему альбинизма, он, по сравнению с фантазиями Линнея, сделал ее намного более понятной. Он также заказал литографию Женевьевы, на которой она стоит рядом с корзиной, полной экзотических фруктов, обнаженная и совершенно белая, как негатив фотоснимка. На лице ее блуждает легкая усмешка, возможно вызванная нелепыми действиями ученых.[228] Палитра Мы представляем собой полихромный вид. Тем не менее в палитре человеческих окрасок всего-навсего два пигмента. Один – эумеланин – отвечает за более темные оттенки кожи, волос и глаз, за брюнетов и черных; другой – феомеланин – за более светлые оттенки, за блондинов и рыжих. Как художник смешивает три основных цвета, чтобы получить все разнообразие остальных, так и различные оттенки нашей кожи обусловлены сочетанием этих двух пигментов.[229] У черных много эумеланина; у рыжих много феомеланина; у блондинов – понемножку того и другого. Альбиносы напрочь лишены пигментов. Сами пигменты вырабатываются в клетках, называемых меланоцитами. Они находятся в верхних слоях кожи, в эпидермисе. Меланоциты упаковывают пигменты в субклеточные структуры – меланосомы, которые затем переносятся в расположенные непосредственно над ними клетки кожи, что и придает ей цвет. Мутации нескольких генов вызывают альбинизм. Наиболее распространенная мутация выключает один из ферментов, используемый меланоцитами при производстве пигмента. В таких случаях даже глаза лишаются окраски, и их краснота обусловлена просвечивающими кровеносными сосудами сетчатки. Отсутствие пигмента делает альбиносов сверхчувствительными к свету, они часто щурятся: отсюда происходят фотофобия и раскосые глаза какурлаков и блафардов. Однако у некоторых альбиносов все же имеется в глазах хоть какое-то количество пигмента. В этих случаях причиной дефекта является белок, несколько загадочно именуемый "P", который используется при расфасовке и транспортировке меланосом.[230] У Женевьевы глаза были серыми, а не красными, и это почти наверняка свидетельствует о том, что обе копии ее P-гена были дефектными. Можно даже предположить, какова была эта мутация. Наиболее распространенная причина альбинизма в Африке – гомозиготность по мутации в P-гене, которая представляет собой делецию 2700 пар оснований. Та же самая мутация, занесенная в процессе работорговли, обнаружена в Карибском бассейне и у черных жителей Соединенных Штатов. Нигде в мире не существует племени, расы или нации альбиносов; и все же упоминание Плинием народа лейцетопов не совсем лишено оснований. Примерно один из 36 000 европейцев родится альбиносом; у африканцев это соотношение составляет 1:10000. У зулусов число подскакивает до 1:4500, а у нигерийских ибо – до 1:1100. В некоторых локальных популяциях частоты альбинизма могут быть еще выше. В 1871 году во время своего путешествия к пигмеям ака Георг Швайнфурт по пути наблюдал такие случаи. Есть одна особая черта, свойственная племени монбуту. Если судить по тем сотням людей, которые из любопытства приходили к моей палатке, и по тем тысячам, которых я видел во время своего трехнедельного пребывания у мунза, я должен сказать, что по крайней мере пять процентов этого населения имеют светлые волосы. Они всегда были мелко курчавыми, как у негров, и всегда сочетались с самой светлой кожей, какую мне приходилось видеть после того как я уехал из Нижнего Египта... У всех индивидов со светлыми волосами и кожей было болезненное выражение глаз, а также имелись многие признаки явного альбинизма.[231] То, что альбинизм может быть столь распространенным, несколько удивляет. По всем свидетельствам, африканским альбиносам он доставляет массу неприятностей. Они не только часто испытывают социальную дискриминацию и с трудом находят брачных партнеров, но из-за отсутствия пигмента не могут долго работать вне помещения, часто подвержены меланомам и другим особенно разрушительным разновидностям рака кожи. Эти селективно невыгодные характеристики должны были бы сделать гены альбиносов, а также самих альбиносов редким явлением. По предположению некоторых генетиков, одна из причин высокой частоты (1 к 200) альбинизма среди индейцев хопи в Аризоне состоит в том, что мужчины-альбиносы, освобожденные от работы в поле, остаются дома и в меру своих сил развлекаются с женщинами. Но все доказательства этой гипотезы базируются на единственном примере неотразимости пожилого джентльмена из племени хопи, которому молва приписывает отцовство полутора десятков незаконных отпрысков.[232] "Пегие" (частичный альбинизм) Эти дети привели бы Бюффона в восторг. Стараясь найти объяснение альбинизму и в попытках постичь еще не существующую теорию наследования, он стремился узнать, каким будет ребенок, родившийся в результате союза альбиноса с партнером, имеющим нормальную пигментацию. Он полагал, что такие дети будут пятнистыми, или пегими. В "Естественной истории" он приводит еще одну литографию. На ней изображена девочка лет примерно четырех, стоящая посреди целого набора экзотических предметов: зонтика, топорика, покрывала, украшенного перьями головного убора. На пальцах ее как бы застывшей в воздухе руки сидит домашний питомец – небольшой попугай. Тело у девочки двуцветное: мозаика черных и белых пятен. Частичный альбинизм. Мари-Сабина, Колумбия, 1749 г. Из книги Жоржа Леклерка Бюффона "Естественная история всеобщая и частная", 1777 (Библиотека Уэллком, Лондон). Бюффон никогда не видел этого ребенка, почти ничего не знал о его происхождении и описал исключительно по картинке. Нарисованный в Колумбии неизвестным художник приблизительно в 1740 году, портрет был отправлен в Европу на испанском судне, которое вскоре было захвачено вест-индской эскадрой военно-морских сил Великобритании. Теперь картина являлась военным трофеем и была отправлена в Каролину, где с нее сделали, как минимум, две копии. Одну из этих копий, а может быть – и сам оригинал, послали в Лондон, но корабль, в свой черед, был ограблен, на этот раз французскими моряками, и картина попала в руки бургомистра Дюнкерка, некоего г-на Таверна, который и отослал ее Бюффону. Так, благодаря Войне за испанское наследство пятнистая девочка Мари-Сабина попала на глаза величайшего натуралиста Европы. Бюффон был в восторге. На его копии портрета, теперь утраченной, было написано следующее: Правдивый портрет Мари-Сабины, которая родилась 12 октября 1736 года в Матуне, на плантации, принадлежащей иезуитам города Картахена в Америке, от двух рабов негров по имени Мартианиано и Патрона. В письме, посланном вместе с портретом, Таверн писал: "Несмотря на имеющуюся надпись, я думаю, что ребенок был плодом союза между белым мужчиной и негритянкой, и, дабы сохранить честь матери и Общества [иезуитов], к рабам которого она принадлежала, было решено указать, что оба ее родителя были черными". Бюффон ответил, что поначалу он счел объяснение Таверна достаточно правдоподобным, но по некотором размышлении усомнился в нем. Существуют тысячи, миллионы людей, в жилах которых смешана кровь черных и белых, и все они демонстрируют однородную коричневую окраску. Возможно, продолжал он, дитя было потомком черного родителя и альбиноса – одного из аномальных блафардов. И это все, что нам известно о Мари-Сабине, за исключением разве что краткого упоминания о ней в книге монаха-иезуита, географа и этнографа Хосе Гумильи "Ориноко в иллюстрациях и обоснованиях: естественная история этой великой реки" (Мадрид, 1745), который вспоминает, что видел ее младенцем в больнице на плантации и сказал матери (восстанавливающей силы после родов), чтобы она оберегала дочь от сглаза. Свой рассказ он заключает выводом, что в своеобразной внешности девочки повинна собака, домашняя любимица, которая, по несчастью, тоже была пятнистой.[233] Предположение Бюффона о том, что пятнистые дети являются потомками альбиносов и негров, продержалось почти двести лет. Конечно, по сравнению с пятнистой собакой Гумильи это было более разумное объяснение, но все равно его столь длительное существование остается загадкой, так как за то время по меньшей мере четыре других пятнистых ребенка с Карибских островов попали на страницы научных журналов, причем ни у одного из них не было родителя-альбиноса. Кроме Мари-Сабины науке стали известны Джон Ричардсон Примроуз Боби (родился в 1774 году на Ямайке), Мадлен (родилась в 1783 году на острове Санта-Лючия), Джордж Александер Граттон (родился в 1808 году в Сан-Винсенте) и Лисби (родился в 1905 году в Гондурасе). Каждый из этих детей в свое время был знаменитостью. Портреты Мари-Сабины ныне висят в Уилльямсбурге, Вирджиния, и в Хантеровском музее в Лондоне; Мадлен удостоилась статуи в Гарвардском университете; а в Марлоу, графство Суррей, находится могила Джоржда Граттона со следующей эпитафией: "Под этим камнем погребен ребенок, чей цвет отличен от других с пеленок".[234] Частичный альбинизм. Лисби, Гондурас, 1912 г. Из книги Карла Пирсона и др. "Монография об альбинизме у человека", 1913 (Библиотека Уэллком, Лондон). Последний из карибских пегих детишек – Лисби – фигурирует в статье британского генетика Карла Пирсона, написанной в 1913 году. Подобно Бюффону, Пирсон полагал, что пятнистость как-то связана с альбинизмом. Он не считал, что мать ребенка имела любовную связь с альбиносом – на семейной фотографии изображена одетая в кружево матрона явно непоколебимых моральных устоев. Вместо этого он задается вопросом о происхождении Лисби, предполагая наличие у него предка-альбиноса. В действительности гипотеза Пирсона была еще несколько сложнее, так как, по мысли ученого, наличие предка альбиноса могло стать причиной пятнистости только в том случае, если кто-то из родителей ребенка обладал особенно темной кожей как это и было с отцом Лисби, которого Пирсон называл "черным, как уголь, негром". Довольно-таки заковыристое объяснение, причем такое, которое трудно понять с современной точки зрения.[235] Теперь мы знаем, что пятнистость не имеет ничего общего с альбинизмом, а вызывается доминантными мутациями в абсолютно ином наборе генов и что эти мутации могут встречаться у людей любого цвета кожи, не говоря уж о лошадях, кошках и породе мышей, которая называется "Splotch"[236]. Они представляются нам не менее удивительными, чем была Мари-Сабина для Бюффона. Помимо всего прочего, они говорят нам о странном происхождении клеток, окрашивающих нашу кожу. Меланоциты проводят всю свою жизнь в коже, хотя и являются по отношению к ней иммигрантами. В то время как большая часть кожи связана с эктодермой, они ведут свое начало от ткани так называемого "нервного гребня". Примерно на двадцать восьмой день после зачатия клетки нервного гребня покидают только что сформированный дорзальный нервный тяж и устремляются к голове плода, где и формируют лицо. Но отдельные клетки нервного гребня путешествуют еще дальше. Как река разделяется на рукава в пределах своего устья, так и ручейки клеток нервного гребня устремляются вниз с откосов дорзального нервного тяжа и достигают самых дальних границ эмбриона. В одной части тела они образуют нервы, в другой – мышцы, и повсюду, где бы ни находились, они вторгаются в развивающиеся железы. Некоторые становятся меланоцитами, которые на довольно ранних стадиях жизни плода внедряются в нижние слои кожи, где и остаются для производства пигмента. Клетки нервного гребня не только формируют наши лица, но и придают им окраску. Для того чтобы из необученных нервных клеток образовались меланоциты, а не какие-нибудь другие виды клеток, равно как и для того, чтобы направить меланоциты к месту их окончательного назначения, нужны соответствующие молекулярные механизмы. Мутации по меньшей мере пяти различных генов вызывают пятнистость кожи, и каждая из них выводит из строя один или несколько таких механизмов, что приводит к появлению лишенных меланоцитов и, следовательно, абсолютно белых участков кожи. У одних людей это выражается всего-навсего в появлении белой пряди волос надо лбом, у других покрывается пятнами тело, у третьих глаза становятся разного цвета. Но встречаются и более серьезные нарушения. Некоторые пятнистые дети страдают тяжелым кишечным заболеванием, известным под названием "расширение толстой кишки", когда нижние отделы кишечника раздуваются по причине постоянных запоров, вызываемых отсутствием кишечных нервов, контролирующих дефекацию. Эти нервы также являются производными нервного гребня. Кроме того, пятнистые дети склонны к глухоте, так как, по-видимому, меланоциты играют какую-то важную роль в строении внутреннего уха.[237] Динка или голландцы Морских свинок, собак, кошек, породы крупного рогатого скота специально выводили для получения разнообразных окрасов, и только люди естественным образом демонстрируют целый спектр оттенков. Чем определяется цвет нашей кожи? Любопытно, что хотя генетики немало знают о причинах аномальной пигментации, им еще только предстоит определиться в отношении генов, отвечающих за различия в цвете кожи, скажем, у представителя племени динка и у голландца. Почему так происходит? Отчасти это объясняется несомненной сложностью проблемы. Генетики сходны во мнении, что различия между темной и светлой от природы кожей определяются не одним, а несколькими генами (будь это всего лишь один ген, его бы к настоящему времени уже определили). Однако при попытке уточнить, сколько именно их существует, возникают разногласия и называются цифры от двух до шести сложным образом взаимодействующих генов, которые и дают любые известные оттенки розового, смуглого, коричневого и черного. Это затрудняет дело. Когда несколько генов, каждый из которых имеет множество вариантов, оказывают совместный эффект на некое свойство человеческого тела, молекулярная идентификация этих генов превращается в сложную задачу прикладной статистики. Если искомое свойство связано с болезнью – сердечным заболеванием или неинсулинзависимым диабетом, генетики охотно принимают вызов по части ее решения. Что же до изучения цвета кожи, то здесь они действуют более осторожно.[238] Их можно понять. С тех пор как Линней разделил все народы мира на четыре расы: азиатов (Asiaticus), американцев (Americanus), европейцев (Europaeus) и африканцев (Afer), цвет кожи стал ошибочно использоваться в качестве удобного маркера других человеческих качеств. Линней выделил свои четыре расы на основе не только цвета кожи, но и особенностей характера. Азиаты были "безжалостными, высокомерными, алчными и подвластными чужому мнению"; американцы – "настойчивыми, самодовольными, желчными и подвластными привычке"; африканцы, явно лишенные каких-либо привлекательных черт, – "коварными, медлительными, флегматичными, беспечными и подвластными капризу". А что же с его собственной расой? Европейцы, по мысли Линнея, были "живыми, веселыми, изобретательными и подчинялись обычаям".[239] Таким было начало интеллектуальной традиции, которая в XIX веке воплотилась в трудах графа Артюра де Гобино, теоретика превосходства арийцев над другими народами, а в дальнейшем достигла наивысшей точки в создании самой продвинутой в мире "хроматократической" государственной системы – апартеида Южной Африки. В течение практически половины столетия архитекторы южноафриканского форпоста держали весь мир в напряжении и тратили большую часть обширных национальных ресурсов на достижение абсолютно безнадежной цели разграничения двух расовых потоков. В бесконечных переговорах по поводу того, кто может, а кто не может сидеть на парковых скамейках с надписью "только для белых", каждый полицейский, судья, работодатель и вообще любой гражданин страны становился экспертом в области расовой идентичности. Южноафриканские законы всегда были намеренно расплывчатыми в отношении того, кого именно следовало считать белым (blank), черным (swart) или цветным (kleurling). На языке апартеида к последней категории относились люди смешанного африканско-европейского происхождения. Отнесение к той или иной категории отчасти зависело оттого, с кем вы были знакомы, откуда были родом и кем вас считали окружающие. Но, помимо этих социальных критериев, существовал и целый набор псевдонаучных тестов, которые, по мысли их сторонников, с неизбежностью выдали бы африканское происхождение у всякого, кто пытался "сойти за белого". Некоторые были убежденными приверженцами "карандашного теста", основанного на том предположении, что карандаш, вставленный в волосы, удержится там только у тех, кто хотя бы отчасти является черным. Другие утверждали приоритет цвета кожи под ногтями или со знанием дела рассуждали о веках и монгольском пятне. Были и такие, кто настаивал на определении цвета гениталий ("тест мошонки"). В школах, больницах, учреждениях, когда, по сути, все аспекты общественной жизни Южной Африки в промежутке между 1948 и 1990 годом определялись принципом сегрегации, судьба ребенка зависела исключительно от цвета любой из частей его или ее тела.[240] В 1973 году сорокалетняя кейптаунская домохозяйка по имени Рита Хефлинг, которая до той поры наслаждалась всеми привилегиями и гарантиями, сопровождавшими жизнь белых южноафриканцев, внезапно начала темнеть. Врачи поставили диагноз болезни Кушинга, связанной с гиперактивностью надпочечников. Железы удалили, и какое-то время все шло хорошо, но затем женщина заметила, что ее кожа опять темнеет. Речь шла не о какой-то смуглоте, наподобие загара, а о глубоком бронзовом оттенке, изменившем всю ее внешность и делавшем ее похожей на цветную. Первые оскорбления были мелкими, на уровне "малого" апартеида. Выброшенная однажды из автобуса "только для белых" ревностным кондуктором, она с той поры всегда носила с собой справку, объясняющую и оправдывающую происхождение ее темной кожи. Однако в Южной Африке времен апартеида любой гражданин мог взять на себя функции уполномоченного по расовым вопросам, и вскоре Рита была вынуждена поменять место жительства – всего лишь затем, чтобы новые соседи тотчас выступили с очередным протестом. Все это происходило в Кейптауне, городе, который даже в те поры отличался максимальным, по южноафриканским меркам, космополитизмом и расовой толерантностью. В конце концов под давлением оказалась и ее семья. Когда умер отец, Рите не разрешили прийти на его похороны. "Я не хочу, – сказала мать, – стесняться твоего темного тела у могилы папочки". Отвергнутая белым сообществом, Рита нашла друзей и поддержку в среде черных африканцев. Они приглашали ее в свои дома в сегрегированных районах города, помогали выжить и не сойти с ума. Она стала свободно разговаривать на языке кхоса. Затем в один прекрасный день 1978 года Рита неожиданно снова сделалась белой. Она попыталась вернуться к своей прежней жизни, но к тому времени муж, бывший офицер военно-морских сил, и дети покинули ее. В последние десять лет своей жизни она существовала на пособие и небольшую пенсию и скиталась по жалким углам в трущобах Кейптауна. В одном из таких углов она и умерла в 1988 году в возрасте пятидесяти пяти лет от бронхопневмонии.[241] Болезнь Риты Хефлинг называется синдромом Нельсона. Она встречается примерно у трети больных, перенесших адреноэктомию. Одна из основных задач надпочечников (как и щитовидной железы) состоит в том, чтобы контролировать гипофиз. В отсутствие надпочечников гипофиз у Риты начал расти, обзаводиться опухолями и продуцировать излишки гипофизарного гормона, что и вызвало потемнение кожи. У Чарли Берна, Ирландского гиганта, тоже была опухоль гипофиза. Может показаться удивительным, что опухоль одного-единственного органа приводит к столь различным последствиям, но гипофиз – это в высшей степени универсальный орган: не просто фабрика гормонов, а индустриальный парк, где каждый из секретируемых им гормонов, общее число которых приближается к десяти, продуцируется группой специализированных клеток. Это означает, что опухоли, затрагивающие различные типы гипофизарных клеток, могут вызывать совершенно различные последствия. Большая часть опухолей гипофиза развивается в клетках, связанных с секрецией гормона роста, и поэтому приводит либо к гигантизму, либо к акромегалии. Гораздо реже опухоль развивается в клетках, продуцирующих группу гормонов, называемых меланотропинами. Подобно гормону роста, меланотропины циркулируют по всему телу. Однако если гормон роста способен воздействовать почти на все клетки организма, влияние меланотропинов носит более избирательный характер. Среди клеток, на которые они оказывают поистине поразительный эффект, – меланоциты. Когда гормон связывается со своим рецептором на меланоците, клетка начинает продуцировать эумеланин – пигмент, придающий темные оттенки нашей коже, волосам и глазам. Подобно тому как избыток гипофизарного гормона роста вызывает чрезмерный рост мышечной и костной тканей, излишек меланотропина заставляет нашу кожу темнеть, по крайней мере так происходит у лиц со светлой кожей. Но меланотропины не просто стимулируют продукцию эумеланина. Дети, лишенные меланотропинов, не блондины, а рыжие. И еще они толстые.[242] А толстые они потому, что среди меланотропинов есть молекула под названием α-меланоцитстимулирующий гормон (α-МСГ), которая способна на большее, чем следует из ее названия. На меланоците она связывается и активизирует молекулу под названием меланоцитстимулирующий гормон (меланокортиновый) рецептор-1, или MC1R. В мозге тем не менее она связывается с другим рецептором, так называемым MC4R, который кодируется иным геном. Мозговой рецептор контролирует аппетит. Когда α-МСГ активизирует MC4R, нейронный сигнал приказывает нам прекратить есть. Дети, у которых отсутствует α-МСГ, страдают ожирением, потому что во время еды просто не знают, когда должны остановиться. И все же далеко не все рыжеволосые толстые. Действительно, порывшись в собственной памяти, каждый скажет, что таковых, в общем-то, мало. Почему так? Ответ, по-видимому, заключается в том, что у большинства рыжих огненные кудри и прозрачная кожа связаны не с отсутствием гормона, а с необычными рецепторами. Если MC1R активен, меланоциты производят эумеланин – коричневый и черный пигменты, если неактивен, продуцируется феомеланин – красный пигмент. У рыжеволосых кельтов рецепторы более или менее постоянно находятся в неактивном состоянии. Эту особенность они делят с рыжими сеттерами, лисицами и шотландской породой хайленд крупного рогатого скота. Отметьте употребление нечеткого определения "необычные". На протяжении всей книги я пользовался языком клинической генетики. Я рассказывал о "мутациях", которые "выводят из строя" белки или делают их "дефектными". Но вокруг нас так много рыжеволосых, что говорить об их генах столь оскорбительным образом чуточку страшновато. И все же остается мучительный вопрос: являются ли рыжие мутантами? Чтобы отнести данную генетическую последовательность к мутациям, а не к полиморфизму, нужно знать две вещи – глобальную частоту ее распространения и степень полезности: мутации редки и вредоносны, полиморфизмы, как правило, – ни то ни другое. Что касается частоты, то рыжеволосые обычно встречаются в Северной Европе (в Абердине их 6 процентов), но повсеместно они редки. Ситуация усугубляется тем, что при подсчете "голов" частота "гена рыжеволосости" завышается. Это происходит потому, что каждая особь с рыжими волосами по-своему необычна. MC1R встречается, как минимум, в тридцать различных вариантах, многие из которых обнаружены в Ирландии. Шесть, а может быть, даже десять из этих человеческих вариантов MC1R в разных сочетаниях дают рыжие волосы, будь то красновато-коричневые, ярко-рыжие, белокурые с апельсиновым или клубничным оттенком. Африканцы, по контрасту, обладают всего одной разновидностью MC1R. В глобальном масштабе любой единичный вариант гена MC1R, отвечающий за рыжие волосы, настолько ускользающе редок, что мы должны, по-видимому, именовать его мутацией, а не полиморфизмом. Но давайте рассмотрим в качестве аргумента полезность гена. Высказывались предположения, что жителям севера нужны светлые оттенки кожи для обеспечения доступа солнечного света при производстве в организме витамина D, без которого у людей развивается рахит, или костные деформации. Дарвин полагал, что разнообразие человеческих окрасок явилось следствием полового отбора, когда одно поколение за другим делало произвольный выбор в пользу более красивых брачных партнеров. Это привлекательная, но труднодоказуемая гипотеза, по крайней мере, если не принимать во внимание утверждение Анри Тулуз-Лотрека, что рыжие обладают особым эротическим запахом. С другой стороны, довольно легко найти аргументы, оспаривающие полезность генов рыжеволосости. Распространение в Африке одного варианта MC1R говорит нам о том, что в тропиках необходима темная кожа, которая, и в этом нет сомнения, защищает от рака кожи. Вдали от мягкого северного света рыжие легко становятся добычей жгучих солнечных лучей. Гены MC1R снабжают их нежным цветом кожи, которая легко сгорает, но не поддается загару. В Австралии многие дети являются потомками шотландских и ирландских иммигрантов, и по австралийским законам все они должны приходить в школу в шляпах и одежде с длинными рукавами. Ни один из этих аргументов нельзя считать исчерпывающим. Но все же доказательства явно предполагают, что рыжий цвет волос, как бы мы им ни любовались, по сути, вообще не нужен. У северных европейцев ген MC1R попросту исчезает ввиду своей бесполезности, подобно тому как исчезли глаза у слепой пещерной рыбы.[243] История Петруса Гонсальвуса и Схве Маонга Бледнолицые, и тем гордящиеся, европейские антропологи XIX столетия привычно делили человечество на группы по цвету кожи. Ученые из других регионов, что, наверное, неудивительно, смотрели на вещи по-иному. По возвращении из европейского турне китайский ученый Чжан Дейи (1847-1919) сообщал своим соотечественникам, что у многих французских женщин длинные бороды и усы. Избегая географических классификаций по цвету кожи, китайские антропологи, в отличие от своих европейских коллег, создавали карты, на которых народы мира изображались по степени обволошенности. Китайцев изумляли айны, народ на севере Японии с довольно развитым волосяным покровом, которых они относили к расе карликовых обезьянолюдей. Разумеется, айны ничем таким не являются. Мужчины айны действительно гордятся длиной своих кудрей на голове и бород (которых они, кстати, никогда не стригут), хотя в целом количество волос на теле у них не больше, чем у многих европейцев. Но ведь ученые комментаторы эпохи Цин и европейских визитеров сравнивали с макаками, и эта милая традиция по сей день сохраняется в Сингапуре, где иностранцев называют ангмо (angmo) или ангмогао (angmogao), что в переводе с языка хоккейн значит "рыжая обезьяна".[244] Наверное, не совсем справедливо обвинять одних китайцев в пристрастии к определению степени волосатости (в конце концов, едва ли приходится сомневаться, что именно белые южноафриканцы придумали "карандашный тест"). Европейцы действительно могли быть волосатыми, но это никогда не делало их особо симпатизирующими людям, у которых волос было еще больше, чем у них. Целый ряд генетических нарушений, называемых "гипертрихозами", вызывает у детей развитие обширного волосяного покрова на носах, лбах, щеках и ушах, конечностях и торсе, то есть на тех частях тела, которые у младенцев обычно остаются едва прикрытыми. Вырастая, эти дети превращались в диких людей (Waldmenschen) или дикарок (femmes sauvages), о которых сообщали первые путешественники; в примитивных людей (hommes primitives) или волосатых людей (Homo hirsutus) в классификациях таксономистов; в собако-, медведе-, обезьяноподобных или львинообразных людей ярмарочных балаганов. В собрании Музея Каподимонте в Неаполе хранится картина Агостино Караччи, старшего из болонских братьев-художников. По краям полотна расположены две фигуры: забавный карлик и бородатый ухмыляющийся мужчина средних лет. Их внимание приковано к третьему персонажу: молодому, хорошо сложенному и спокойному человеку, сидящему между ними. Это, судя по всему, дикий, лесной человек. Не считая легкой накидки, на нем нет никакой одежды; лицо его покрыто волосами – не просто боровой, а длинными прядями, которые растут и на щеках и на лбу. Пышная растительность, составляющая фон картины, а также попугай, две обезьянки и две собаки довершают буколическую сценку. Всю картину можно было бы принять за аллегорию Природы, если бы не ее название – "Волосатый Арриго, безумный Петр и карлик Амон", которое говорит нам, что в действительности это перечень обитателей зоопарка. Ланугинозный гипертрихоз. Арриго Гонсальвус, Рим, 1599 г. Деталь картины Агостино Караччи "Волосатый Арриго, безумный Петр и карлик Амон" (Музей Каподимонте, Неаполь). Картина, написанная по заказу кардинала Одоардо Фарнезе, была закончена в 1599 году. По сравнению с великолепными интерьерами Палаццо Фарнезе в Риме, которые уже создали для него братья Караччи, это была всего лишь мелочь, небольшой пустячок. Рядом с дворцом, где сейчас помещается французское посольство, находился ботанический сад и маленький зверинец, питомцы которого почти наверняка и послужили моделями для коллективного портрета. Дикий человек, подаренный кардиналу его родственником Рануччо Фарнезе, также жил в зверинце. Его статус и происхождение можно определить по одежде. На нем тамарко – накидка гуанчей, некогда населявших остров Тенерифе в Канарском архипелаге, которые в дальнейшем были быстро порабощены и в основном уничтожены захватившими их около сотни лет назад испанцами. Арриго Гонсальвус – таким было полное имя дикого человека – сам не относился к гуанчам. Однако он был сыном одного из представителей этого племени, притом весьма необычного. В 1556 году при дворе французского короля Генриха II появился Петрус Гонсальвус, возможно привезенный туда как раб с Тенерифе. Ему, должно быть, было не более двенадцати лет, но густая шерсть уже скрывала черты его лица. С ним как будто бы неплохо обращались и даже дали ему какое-то образование. В 1559 году после смерти короля Гонсальвус появляется при дворе Маргариты, герцогини Пармской, деспотичной правительницы Испанских Нидерландов. Там он женится на молоденькой и весьма хорошенькой голландочке, которая родила ему, как минимум, четверых детей, трое из которых, в том числе и Арриго, также были чрезмерно волосатыми. В 1582 году Маргарита Пармская вернулась в Италию вслед за ней отправились и члены волосатой семьи. Их считали чудом, природной диковинкой, которая не могла оставить равнодушными Габсбургов и Фарнезе. Эрцгерцог Фердинанд II Тирольский заказал серию отдельных портретов для своей Комнаты чудес (Wunderkammer) в замке Амбрас возле Инсбрука. Там их можно увидеть и по сей день в его коллекции других природных чудес. Групповой портрет членов семьи, выполненный Георгом Хофнагелом, появляется в иллюстрированном "Бестиарии" Рудольфа II, австрийского императора и племянника Фердинанда. Это были единственные люди, изображенные в книге. Вероятно, самый привлекательный из многих портретов членов этого замечательного семейства принадлежит кисти болонской художницы Лавинии Фонтана. Это портрет младшей сестры Арриго – Тоньины, на котором изображена маленькая волосатая девочка в серебристом кружевном платье. Она мило улыбается, держа в руках бумагу с описанием семейной истории, и напоминает необычно умную и очень приветливую кошечку. Альдрованди говорит о Петрусе Гонсальвусе как о "диком человеке" с Канарских островов и высказывает твердое убеждение, что там существуют и другие люди, подобные семье Гонсальвус, – раса волосатых людей. Конечно, ее не существовало. Петрус Гонсальвус был всего-навсего человеком, родившимся с мутацией, которая вызывала рост волос на таких частях лица и тела, какие у большинства людей остаются необволошенными. О дальнейшей судьбе Петруса, его жены и сына ничего не известно. Мы знаем, однако, что дочь Петруса Тоньина в конце концов вышла замуж и родила несколько детей, столь же волосатых, как и она сама. Ланугинозный гипертрихоз. Петрус Гонсальвус, Австрия, ок. 1582 г. Неизвестный художник немецкой школы (собрание замка Шлосс / Музей истории искусств, Вена). Можно было бы подумать, что все портреты преувеличивают семейную предрасположенность к росту волос, однако это вовсе не так. Подробности путешествия семьи Гонсальвус по Северной Италии были зафиксированы тем самым Улиссе Альдрованди, неутомимым знатоком природы, который в то время занимал пост профессора естественной истории в Папском университете Болоньи. В своей "Истории монстров" он рассказывает о встречах с семьей, тщательно описывает особенности ее членов и приводит четыре ксилографических портрета. Некоторые специалисты полагают что в облике безумного Петра, который не сводит глаз с волосатого человека на картине Агостино Караччи, изображен сам Альдрованди. В поддержку этой очаровательной причуды может свидетельствовать тот факт, что бородач действительно похож на Альдрованди. Кроме того, художник и естествоиспытатель знали друг друга со студенческой скамьи. Но в 1599 году Альдрованди уже почти исполнилось семьдесят, а безумный Петр явно пребывает в расцвете сил.[245] Петрус Гонсальвус и его семья были не единственными людьми с гирсутизмом, вызывавшими любопытство у королей. В 1826 году Джон Крафорд, британский дипломат и естествоиспытатель, посетил бирманскую столицу Ава, к северу от Мандалая. На троне восседал Баджидо из династии Конбаунов, которая была знаменита в основном своими дикими приемами борьбы за власть. (Один из предшественников Баджидо ознаменовал свое восхождение на престол в 1782 году тем, что уничтожил своих братьев, их семьи и несколько сот подданных, устроив из них гигантский погребальный костер.) Конбауны были также экспансионистами, и их политика вызывала ярость доминирующей в этом регионе силы в лице британского правительства в Индии. После 1-й Англо-бирманской войны бирманцам пришлось принять условия унизительного мира. Договор был привезен в Аву Крафордом, который застал при дворе Баджидо сцены средневековой пышности с участием белых слонов и людей-альбиносов. Там же он увидел и Схве Маонга. Крафорд писал: Мы были много наслышаны об особе, будто бы покрытой волосами, которая, как утверждали, больше походила на обезьяну, чем на человеческое существо; это описание, однако, как я рад сообщить, совершенно не соответствовало его внешности... Весь лоб, щеки, веки, нос, в том числе и внутренняя его часть, подбородок – короче, все лицо за исключением красноватой части губ, было покрыто у этого человека мягкими волосами. На лбу и щеках они были длиной до восьми дюймов, а на носу и подбородке – до четырех дюймов. По цвету они были серебристо-серыми, а по фактуре – шелковистыми, тонкими и прямыми. Задняя и внутренняя поверхность уха, также как и внутренность наружной ушной раковины, были полностью покрыты волосами, точно такими же, как и на лице, около восьми дюймов длиной. Именно эта особенность главным образом способствовала тому, что на первый взгляд его внешний вид казался неестественным и почти нечеловеческим. Схве Маонг был родом из горного племени лао. В пять лет местный вождь отправил его в качестве подарка во дворец Баджидо. Хрупкого сложения, со светло-карими глазами, он жил как придется, плел корзины и играл роль шута. Мальчиком он научился подражать обезьянам, которые обитали в тиковых лесах бирманской глубинки. Когда Схве Маонгу минуло 20, Баджидо женил его на придворной красавице, от которой у него родилось четверо детей, из которых девочка по имени Мафоон, "крепкая и очень миленькая", также была волосатая. Когда она родилась, волосатыми были только ушки, но к шестимесячному возрасту все ее тело покрылось мягким серым пухом. Крафорд увидел ее, когда ей исполнилось два или три года, – лица ее к этому моменту нельзя было разглядеть. Через тридцать лет после описания Крафорда Мафоон снова появляется в отчетах другой дипломатической миссии, посланной в Аву для улаживания отношений с по-прежнему беспокойными Конбаунами. К тому времени она стала зрелой женщиной очень похожей на отца, давно уже умершего. Шелковистые волосы струились по ее лицу, оставляя открытыми только глаза и губы. Шея, грудь и руки также были покрыты мягким пухом, а кроткими манерами она сильно напоминала отца. Она была замужем – наследник Баджидо, возможно, движимый интеллектуальным любопытством, предложил вознаграждение любому мужчине, который возьмет ее в жены. У нее было двое мальчиков, таких же волосатых, как и она сама. Один из них впоследствии женился, и на фотографии, сделанной, вероятно, около 1875 года, изображены три поколения семьи: Мафоон, ее сын и его дочь – все одинаково заросшие волосами. Ланугинозный гипертрихоз. Мафоон, Бирма, ок. 1856 г. Е.Х. Манн (Королевский антропологический институт Великобритании и Ирландии). В 1885 году в результате 3-й Англо-бирманской войны британцы окончательно покорили Верхнюю Бирму. Дворец в Аве был разрушен. Мафоон вместе с семьей убежала в лес, где спустя несколько недель их обнаружил офицер итальянской армии, который и убедил всех отправиться в Европу. Именно там летом 1886 года они выступали в Египетском холле на Пикадилли и в "Фоли-Бержер" в Париже. И это последнее, что мы знаем о семье Схве Маонга.[246] Топография волос Мы рождаемся почти с пятью миллионами волосяных фолликулов, и больше их у нас никогда не будет. Фолликулы расположены рядами, причем так, что соседние фолликулы чередуются друг с другом в строго определенном порядке. Как создается эта очередность? Если бы волосяные луковицы были просто разбросаны на коже головы случайным образом, у каждого из нас в волосяном покрове имелось бы по меньшей мере несколько проплешин. Вопрос о том, как достигается столь регулярное расположение фолликулов, глубок и сложен. Это вопрос о том, как можно добиться порядка на пустом месте. Трудность заключается в слове "регулярное". Довольно легко представить, каким образом организм создает уникальные части – например, пять пальцев на руке. Здесь речь идет всего лишь о наличии заранее запрограммированных клеток, которые реагируют на единый градиент в концентрации определенных молекул. И в самом деле, наши пальцы формируются именно таким образом. Но что, если вместо руки с пятью неповторимыми пальцами кому-то захотелось бы иметь руку, где чередовались бы пальцы только двух типов, к примеру безымянный и указательный? Получилась бы странная разновидность кисти, что-то вроде: безымянный-указательный-безымянный-указательный-безымянный. Таких рук никогда не существовало. Но, по сути, наша кожа решает именно эту проблему. Из безликого эмбрионального однообразия кожа должна как-то упорядочить себя, образовав решетку регулярно расположенных волосяных фолликулов, разделенных кусочками кожи. Несомненно, что здесь нужен некий тонкий механизм. Точная форма этого механизма пока что неясна, но логика его действия очевидна. Требуется способ создания волосяных фолликулов, но такой, чтобы они возникали не везде. У плода первые фолликулы начинают появляться примерно в три месяца после зачатия. При этом все пять миллионов волосяных фолликулов возникают далеко не сразу: вначале они появляются на бровях, затем, подобно сыпи, распространяются сперва по остальной голове и лицу, дальше вниз – по шее, горлу и туловищу, потом по бедрам и плечам и, наконец, вниз по рукам и ногам. Мне нравится это сравнение с сыпью, так как оно предполагает распространение какого-то инфекционного изменения в клетках кожи, которое начинается из небольшого очага и разносится во все стороны. Это изменение выводит кожные клетки из состояния покоя, и они приобретают способность продуцировать фолликулы. Вероятно, клетки включаются в этот процесс одна за другой. Возможно, что начинается он с какой-то одной клетки, расположенной в районе лба, которая затем индуцирует такие же изменения в соседних клетках, а те в свою очередь передают преобразования соседним и так далее, и так далее. Никто пока в точности не знает, какова природа этих изменений, но некоторые догадки на сей счет все же возможны. Каждый волосяной фолликул – это химера, гибрид двух различных тканей. Впрочем, как и сама кожа. Кожа которую мы видим и трогаем, которая подвержена атмосферным воздействиям и успешно противостоит им, – это эпидермис, или несколько слоев клеток, происходящих из наружного зародышевого листка, эктодермы. Под эпидермисом находится другой, более толстый слой дермы, происходящий из мезодермы. Тесное сотрудничество эпидермиса и дермы приводит к созданию волосяного фолликула. Взаимоотношения этих двух слоев между собой можно сравнить с беседой, непрерывным молекулярным диалогом, когда каждый сигнал сопровождается ответом на него. Это подтверждается простым, хотя и несколько эксцентричным экспериментом. В 1999 году супруги-ученые, испытывающие сильную привязанность не только друг к другу, но и к науке, поставили опыт на себе, выступив в роли морских свинок. Они иссекли кусочек дермы из кожи на голове супруга, а затем трансплантировали его на лишенный волос участок внутренней стороны руки супруги. Как ни удивительно, отторжения тканей мужа (в иммунологическом смысле) не произошло: по-видимому, волосяные фолликулы каким-то образом защищены от опеки иммунной системы. Так или иначе, вскоре после заживления раны на руке у супруги, в том месте, где была сделана пересадка, начали отрастать длинные волосы. Эксперимент показал, что у дермы есть голос, которым она говорит эпидермису: делай фолликул здесь. В самом деле, то изменение, которое, как сыпь, распространяется по всему телу плода и приводит к развитию волосяных фолликулов, возникает именно в клетках дермы, последовательно обретающих голос, – они становятся разговорчивыми почти повсюду и по неизвестной причине молчат лишь на кончиках пальцев, ладонях, подошвах, губах и гениталиях. Если в этих разговорах слоев кожи дерма дает инструкции, открывая диалог, то эпидермис пользуется правом незамедлительного ответа. По мере того как клетки дермы, обретая активность, призывают эпидермис к созданию фолликулов, последний должен регулярно и твердо отвечать отказом на это предложение. Если бы он этого не делал, вся кожа плода превратилась бы в гигантский волосяной фолликул, а возможно, и в опухолевидную массу недоразвитых фолликулов и волос. Именно ответами эпидермиса определяется характер расположения волосяных луковиц. Каждый вновь образованный фолликул дает команду, запрещающую находящимся вокруг него клеткам эпидермиса также становиться волосяными фолликулами. При этом каждый вновь образованный фолликул не только запрещает соседним клеткам слушать настойчивые уговоры дермы, но и вообще полностью отключает их. Словами в этом разговоре служат сигнальные молекулы, подобные тем, которые нам уже встречались прежде. Хорошими кандидатами на роль ингибиторов эпидермиса служат костные морфогенетические белки (BMP). Перья птиц отдаленно напоминают волосы млекопитающих, и если бусинку, смоченную в BMP, поместить на кожу куриного эмбриона, перья на этом участке не вырастут. В таком же эксперименте с применением фибробластного фактора роста образуются дополнительные, хотя и странным образом деформированные перья, – возможно, это изначальный стимул, индуцирующий рост волос. Те же молекулы, как полагают, работают и у нас, аналогично воздействуя на волосяные фолликулы. Но сигналы вокруг развивающегося фолликула столь разнообразны, многочисленны и динамичны, что трудно понять, что именно там происходит. Мы знаем, однако, что мыши, выведенные путем генетической инженерии с дефектами в стимулах роста фолликулов, часто бывают лысыми.[247] Земля без колосьев Есть один вопрос, на который многие из нас отчаянно хотят получить ответ, когда речь заходит о волосах: почему мы все-таки их теряем? При подсчетах, сколько именно мужчин страдает от андрогенной алопеции, или облысения по мужскому типу, важно знать, что именно подразумевается под этими терминами. Однако в целом можно привести следующие цифры: до 20 процентов мужчин-американцев лысеет в возрасте двадцати-тридцати лет, 50 процентов – в возрасте от 30 до 50 и 80 процентов – в возрасте от семидесяти до восьмидесяти лет. Облысение – это воистину удел белого человека: у африканцев, жителей Восточной Азии и американских индейцев вероятность облысения в течение жизни составляет менее 25 процентов. Это нарушение, с медицинской точки зрения совершенно безопасное, многих приводит в уныние. Когда Овидий писал в "Искусстве любви"[248]: "Стыдно быку без рогов, и стыдно земле без колосьев, Стыдно кусту без листвы, а голове без волос", – он выражал общее мнение. По меньшей мере в течение столетия американцы указывают явную антипатию лысым мужчинам на выборах в высший орган власти страны. За исключением Джеральда Форда (1974-1977), который, будучи лысым, пришел к власти не в результате выборов, последним лысым президентом был Дуайт Д. Эйзенхауэр (1953-1961). Европейцы с большей симпатией относятся к плешивым политикам (Черчилль, Папандреу, Симитис, Жискар д'Эстен, Миттеран, Ширак, Кракси, Муссолини), но даже они не могут сравниться с жителями Советского Союза, где по необъяснимой причине регулярно чередовались, хотя их трудно считать избранными, лысые и волосатые вожди: Ленин (лысый), Сталин (волосатый), Хрущев (лысый), Брежнев (волосатый), Андропов (лысый), Черненко (волосатый), Горбачев (лысый). Эта традиция сохраняется и в Российской Федерации: Ельцин (волосатый), Путин (с зачесом над лысиной).[249] В чем причины облысения? Сэмюэль Джонсон приводил следующее объяснение: "Причина облысения мужчины заключается в высыхании мозга и его сжатии внутри черепа". Эту точку зрения можно легко сбросить со счета, как и другую теорию, популярную в XX веке, которая связывала потерю волос с ношением шляп. Однако дерматологи не спешат предлагать более убедительные объяснения. Склонность к облысению – это, очевидно, семейное свойство, но утверждения о том, что оно возникает вследствие единичной рецессивной мутации или "наследуется по материнской линии" (рецессив, связанный с X-хромосомой), неверны. Облысение по мужскому типу вызывается несколькими генами, ни один из которых до сего времени еще не идентифицирован. Но какими бы они ни были, они должны оказывать влияние на жизненный цикл волосяного фолликула. Волосяные мешочки имеют своеобразную привычку разрушаться, а потом восстанавливаться. Большую часть времени они просто производят волосы. Отдельный фолликул с кожи головы может работать над выращиванием одного волоса где-то от двух до восьми лет: чем дольше длится этот процесс, тем длиннее становится волос. У мышей фолликулы трудятся над производством каждого волоса не более двух недель, поэтому шерстка у мышей очень короткая. К концу ростового периода фолликул начинает уменьшаться в размерах и отмирает, после чего волос выпадает. Однако примерно на середине фолликула имеется выпячивание клеток эпидермиса – "стволовые клетки", которые обладают двумя замечательными особенностями: они бессмертны и могут становиться любым типом эпидермальных клеток, из которых образуется фолликул. Они-то и составляют ту самую материю, которая идет на регенерацию фолликула.[250] Но только не у лысых мужчин. Вместо возрождения полностью продуктивного фолликула у них образуется бледная и слабая его копия – подобие фолликула, способное произвести только очень тонкие волосы. Почему так происходит, остается загадкой. Один факт тем не менее известен: чтобы облысеть, необходим тестостерон, и притом в больших количествах. В том же отрывке "Истории животных", в котором Аристотель рассказывает о высокорослости евнухов, он упоминает также о том, что они не лысеют.[251] Это наблюдение было подтверждено в 1913 году при изучении последнего евнуха Оттоманской империи. Первое тщательное свидетельство того, что именно тестостерон, а не какой-то иной из тестикулярных гормонов, к примеру эстроген, является причиной облысения, было получено в 1942 году в исследовании американского врача Джеймса Хамильтона. Некоторые из изученных им пятидесяти четырех евнухов родились без яичек; другие были кастрированы в раннем возрасте по медицинским показаниям (например, из-за паховой грыжи). Хэмильтон не сообщает, откуда он взял остальных своих испытуемых, хотя одна из более поздних его статей содержит намек на то, что это были умственно отсталые индивиды, кастрированные в психиатрических учреждениях штата Канзас в мальчиковом возрасте, в соответствии с программами по евгенике, которые процветали в Соединенных Штатах вплоть до 1960-х годов (а в некоторых странах и того позже). В полном согласии с утверждением Аристотеля ни у одного из мужчин, кастрированных до окончания периода полового созревания, не обнаружилось никаких признаков облысения. У них даже не увеличилась относительная высота лба, как это случается почти у всех взрослых мужчин. Это происходило не потому, что они были родом из семей с хорошими волосами – у многих среди родственников были явно лысеющие мужчины. Доказательство, что в основе юношеской шевелюры евнухов лежит отсутствие тестостерона, было получено тогда, когда Хамильтон стал давать испытуемым добавки мужского полового гормона, от чего у них начали выпадать волосы. Как только он прекращал лечение, волосы снова начинали быстро отрастать.[252] Вероятно, на том основании, что для облысения мужчинам нужны тестикулы, возникло представление о необычайных мужских качествах преждевременно теряющих волосы индивидов. Это утверждение окружено ореолом восторженной шумихи. (Якобы даже Юлий Цезарь радовался прозвищу "лысый соблазнитель".) Конечно, существует печальная ирония в том, что гормон, отвечающий за рост бороды у мужчин в юности, позднее уничтожает волосы на их головах. Однако нет прямых доказательств, что рано лысеющие мужчины имеют больше тестостерона или что у них родится больше детей, чем у их сильнее обволошенных ровесников. С другой стороны, именно отсутствие тестостерона, вероятнее всего, предохраняет женщин от облысения. Женщины, у которых по тем или иным причинам обнаруживаются аномально высокие концентрации тестостерона, характеризуются не только ростом бороды, но и тенденцией к облысению, так как гены облысения у них, до того молчащие начинают проявлять свое действие. Есть ли у лысых хоть какая-то надежда? В противовес широко распространенным заблуждениям, сбривание волос не стимулирует их роста. Волосы от этого не делаются гуще или темнее, поэтому не имеет смысла уничтожать то малое, что у вас осталось, если, конечно, не руководствоваться эстетическими причинами. Лучше воспользоваться ингибитором дигидрокситестостерона (ДГТ), более мощного варианта тестостерона. По крайней мере, именно на этом основан один из способов лечения, весьма популярный в настоящее время и, говорят, достаточно эффективный. Если же он вас не привлекает (у небольшого числа получавших этот курс лечения в качестве побочного эффекта развивалась импотенция), тогда вскоре можно будет воспользоваться другими технологиями. Спящий волосяной мешочек у молодой мышки можно заставить продуцировать волос, если ввести вирус, обеспечивающий высокие концентрации соник-хеджхога. Избыток соника, вероятно, вызывает пролиферацию стволовых клеток на бугорке фолликула. Если то же самое удастся сделать с деформированными фолликулами на коже головы у лысых, тогда наверняка в ближайшее время можно рассчитывать на появление радикального способа борьбы с облысением. Но что, если волосяные фолликулы на голове у лысых нельзя регенерировать? Значит, нужно создать новые. И это вполне решаемая задача. Мыши, выведенные путем генной инженерии для избыточной продукции особой формы белка, формируют новые волосяные мешочки в таком возрасте, когда нормальные животные на это уже не способны. К сожалению, и соник-хеджхог и β-катенин – это исключительно мощные молекулы. Излишек любой из них приводит к возникновению опухолей волосяных фолликулов, что вызвано опять-таки теми же дополнительными стволовыми клетками. Судя по всему, не так уж трудно стимулировать кожу на создание новых волос; куда труднее контролировать этот процесс.[253] Под покровом голой обезьяны Четыре столетия и два континента, разделяющие Петруса Гонсальвуса и Схве Маонга, не могут скрыть удивительного сходства между ними. Если бы Петрус скинул свои богатые темные одежды с алыми отворотами и повязал бы кусок ткани вокруг бедер, два мужчины выглядели бы как братья. Однако в XIX веке некоторые ученые, например Карл фон Зибольд и Александр Брандт, были поражены сходством волосатых людей с орангутанами. Под влиянием новой теории дарвинизма они предположили, что чрезмерная волосатость – это атавизм. По сути, это была новая версия древней формулировки со знаком равенства между волосатостью и звериными свойствами, хотя и облаченная в научную терминологию; но вышеупомянутые ученые были достаточно осторожны и отмечали, что волосатые субъекты, хоть и выглядят как обезьяны, являются на самом деле людьми.[254] И до сих пор можно иногда наткнуться на утверждения о том, что мутации, приводящие к чрезмерному росту волос, выявляют шерсть под покровом голой обезьяны. Однако есть причины считать, что атавистическая гипотеза неверна – по крайней мере, в отношении этих двух семейств. У волосатых бирманцев, как и у обросших шерстью жителей Канарских островов, согласно описаниям, были исключительно мягкие, шелковистые волосы, которые на самом деле совсем не напоминали ни грубую шерсть, покрывающую тело взрослых человекообразных обезьян, ни волосы, растущие на голове или лобке у человека. Более того, крупные человекообразные обезьяны при всей своей волосатости уступают в этом отношении чрезмерно волосатым людям. У Петруса и Схве Маонга носы, щеки и уши также были покрыты волосами, а у человекообразных обезьян шерсть на этих местах практически отсутствует. Тогда откуда же происходит этот избыток волос? Один из возможных источников кроется в развитии плода. Примерно через пять месяцев после зачатия тело каждого человеческого плода покрывается плотным волосяным покровом, лануго. Волосы эти мягкие и шелковистые, длиной менее сантиметра, впоследствии загадочным образом исчезают: спустя несколько недель после того, как выросли, они выпадают. И если бы дети иногда не рождались с остатками лануго (например, на ушах), мы вряд ли бы вообще узнали о наличии этого волосяного покрова. Кажется вероятным, что мутация, которая присутствует в семьях волосатых людей, способствует сохранению лануго. Вместо перехода к нормальному типу оволошения, свойственному подросткам, а затем взрослым, состояние волосяных фолликулов в этих семьях навсегда сохраняет фетальный статус.[255] И это касается не только волосяных мешочков. В своем описании Схве Маонга Джон Крафорд отметил, что у волосатого бирманца было всего девять зубов: четыре резца и один клык в верхней челюсти, четыре резца в нижней и ни единого моляра ни там, ни тут. У Мафоон, дочери Схве Маонга, зубов было еще меньше. Тщательные обследования показали, что речь шла не о выпадении отсутствующих зубов, а об их непрорезывании. Все выглядело так, как будто бы развитие зубов и волос попросту остановилось где-то на шестом месяце внутриутробной жизни, тогда как весь остальной организм продолжал успешно расти. Дарвин и сам знал о бирманском волосатом семействе. В книге "Происхождение человека и половой отбор" (1859) он пишет о том, что приданое, потребное для того, чтобы выдать Мафоон замуж, служит доказательством всеобщей непривлекательности чрезмерно волосатых женщин.[256] Никогда, однако, он не рассматривает волосатость в качестве атавистического признака. Зато его интересует связь между волосами и зубами. Некто м-р Уедербурн рассказал ему об индусской семье в Синде, нынешнем Пакистане, у членов которой – десяти мужчин в четырех поколениях – зубы практически отсутствовали. Однако эти мужчины не были волосатыми, напротив, они облысели практически с момента рождения. У этих лысых, беззубых индусов также отсутствовали потовые железы. Не способные к потоотделению, они увядали в жарком климате Хайдарабада. Волосы, зубы, потовые и молочные железы (хотя Дарвин о последних не упоминает) – все эти на первый взгляд столь различающиеся по своему назначению и по плану строения органы на самом деле теснейшим образом связаны. В местах, где они расположены, кожа разрастается или образует пустоты для создания чего-нибудь новенького. Простая трубочка, представляющая собой волосяной фолликул, мощная наковальня из дентина и эмали, каковой является зуб, и выступающая тяжесть протоков, образующих молочную железу, – все это вариации на одну и ту же архитектурную тему. Генетические нарушения – а их более сотни, – поражающие одни из этих органов, часто наносят вред и другим. Эти органы не просто связаны своим происхождением с кожей. Они и построены сходным образом. Пока волосяные фолликулы формируются по всему эмбриональному эпидермису, другие эпидермальные клетки скапливаются вместе или создают полости для образования зубов или молочных желез. Подобно фолликулам волос, каждый из этих органов представляет собой химеру, так как частично они образованы из эктодермы, частично – из мезодермы. О родстве между всеми этими органами свидетельствуют формирующие их молекулярные сигналы. "Индусы" все еще живут неподалеку от Хайдарабада, где их по ошибке называют буддистами, тогда как в действительности они мусульмане. В 1934 году представители шести поколений "буддистов" образовывали восемь семейств. Сейчас число их намного увеличилось. Благодаря своей характерной внешности, они считают друг друга родственниками, но имя своего прародителя-мутанта давно позабыли. Как и сообщал в письме Дарвину его корреспондент, у них нет ни потовых желез, ни зубов (за исключением вдруг появившегося у кого-то моляра), но они все же обладают хоть и небольшой, но шевелюрой. Они – носители мутации гена, кодирующего белок эктодисплазин, который получил свое название вслед за нарушением, вызываемым его отсутствием: эктодермальная дисплазия.[257] Мутацией того же гена можно объяснить появление мексиканской голой собачки. Прозванная лысой собачкой, или ксолоитцкуинтль, собачка будто бы была выведена ацтеками еще в XIV столетии, возможно, для мяса, а скорее всего – как постельная грелка. Она тоже лысая, беззубая, с морщинистой сухой кожей из-за недостатка сальных желез.[258] Еще более тесная родственная связь между органами обнаруживается благодаря одной странной разновидности аквариумных рыб. Примерно с основания сегуната Токугавы, то есть с начала XVII столетия, японские любители рыб вывели породу медака (Oryzias latipes), небольшую рыбку которая обычно живет на рисовых полях. Этих рыбок, своеобразную забаву бедняков, можно купить в японских городах в любом ночном магазинчике, причем во множестве разновидностей: альбиносов, пятнистых, с длинными плавниками – и мутантов без чешуи. Отсутствие покрова у рыбок медака, как и у индусов-буддистов, вызвано мутацией, выводящей из строя сигналы эктодисплазина.[259] Использование одной и той же молекулы при формировании человеческих зубов, волосяных фолликулов и потовых желез – наследие эволюционной истории, общей для всех этих органов.[260] Очевидно, эту историю разделяют также – в той или иной степени – перья птиц и чешуя рыб и рептилий. Все эти органы эволюционировали из какого-то простого кожного образования, имевшегося у некоего отдаленного, давно исчезнувшего предка позвоночных. Никто в точности не знает, каким был этот орган. Вернее всего предположить, что он напоминал зубообразные чешуи, придающие коже акулы ее шершавость. Наличие правильного сигнала может даже привести к неожиданному воскрешению органов, давно исчезнувших в процессе эволюции. У птиц нет зубов, но у их предшественников-динозавров они, несомненно, были. Если кусочек эктодермы с клюва куриного эмбриона пересадить на кусочек мезодермы, взятой из нижней челюсти зародыша мыши, а потом все это поместить в глазную орбиту молодой мышки, куриная ткань, лишенная зубов в течение 60 миллионов лет, внезапно начнет их продуцировать, и тогда появятся куриные зубки, напоминающие по форме маленькие моляры, построенные из дентина и эмали.[261] Это означает, что молекулярные сигналы, которыми пользовался Tyrannosaurus rex для создания своих могучих клыков, не отличаются от тех, с помощью которых формируются миниатюрные моляры у маленькой мышки. Эти-то сигналы, по-видимому, и были утрачены у птиц. Возможно, в основе появления добавочных сосков или даже грудей у некоторых людей лежит та же самая причина – возрождение древней системы сигналов, частично похороненной в процессе эволюции. У людей и человекообразных обезьян имеется только два соска, но у большинства млекопитающих их больше. Иногда дополнительный сосок – всего лишь маленькое темное пятнышко, расположенное где-то на животе; но бывает и так, что на теле появляются полностью сформированные лишние грудные железы. Добавочные соски встречаются довольно часто: от 2 до 10 процентов населения обладает по меньшей мере одним таким образованием. У европейцев дополнительные соски или груди обычно располагаются ниже соответствующих нормальных органов, часто прямо на линии, идущей от обычного органа к животу. Любопытно, что у японских женщин дополнительные органы располагаются выше нормальных, нередко под мышками.[262] Дополнительные молочные железы на бедре (Библиотека Уэллком, Лондон). Подобное появление добавочных сосков заставляет вспомнить древние "молочные линии" – десять пар расположенных в два ряда сосков, которые тянулись от подмышек до бедер у некоторых предковых млекопитающих. Молочные железы в подмышках найдены у лемуров (Gaelopithecus volans), а рекордное число сосков, обнаруженных у одного человека, равняется девяти – пять с одной стороны туловища, четыре с другой. Где бы они ни находились, дополнительные молочные железы работают в точности как нормальные: они разбухают и даже выделяют молоко во время беременности. Имеются сведения о том, что женщины вскармливали детей из дополнительных, расположенных на бедрах, молочных желез. Дополнительные соски и груди регулярно появляются в некоторых семьях, хотя вызывающая их мутация (или мутации) пока что не идентифицирована. Тем не менее группа лондонских ученых пытается определить мутацию в линии мышей, имеющих восемь сосков вместо обычных шести. Они уже назвали новый ген "скараманга" ("scaramanga"), по имени злодея в фильме о Джеймсе Бонде "Человек с золотым ружьем", у которого как символ его преступной натуры имелся дополнительный сосок в верхней части грудной клетки с левой стороны.[263] Артемида Эфесская Разговор о груди возвращает нас к Линнею. В 1761 году, став знаменитым после публикации "Системы природы", Линней выпустил в свет одну из своих менее известных работ: обзор животных Швеции под названием "Фауна Швеции". Заглавие было революционным: термин "фауна" – от римского имени бога Пана – был впервые использован для подобного труда. Это был прямой аналог изобретенного ранее и к тому времени широко распространенного термина "флора". Для фронтисписа своей книги Линней выбрал любопытный символ, изображение греческой богини Артемиды, или Дианы, Эфесской. Мы не знаем, почему он предпочел именно этот образ, но можем высказать на этот счет некоторые предположения. Артемида Эфесская была в силу необъяснимой двойственности греческих божеств одновременно богиней природы и городов. В изначальном воплощении как объект культа, процветавшего в Малой Азии около VI века до н.э. она считалась защитницей от злых сил, и ее образ помещали на городских стенах в окружении отличительных признаков страны, изображений виноградных гроздьев и льнувших к ней животных наподобие львов, змей, птиц и гарпий. Извлеченная из эфесских руин, в XVIII веке она стала символом дикой природы и разума. Якобинцы даже посвятили ей Храм разума, который некогда возвышался в Страсбурге, но до нашего времени не сохранился. Возможно, поэтому Линней поместил ее в самом начале своей "Фауны" в знак победы Разума над Природой, хотя и шведской: разлученная со своей средиземноморской родиной, Артемида стоит среди прогуливающихся оленей.[264] Артемида Эфесская в Швеции. Фронтиспис книги К. Линнея "Фауна Швеции" (Библиотека Уэллком, Лондон). А может быть, Линней руководствовался иными, более простыми соображениями. В его Артемиде самым поразительным являются не окружающие ее животные, а четыре выступающие груди. В этом она прямо повторяет свои статуи времен античности, где она всегда представала с многочисленными возвышениями на груди и животе. В эпоху Ренессанса эти вздутия однозначно интерпретировались как случаи крайней полимастии, но более скептически настроенные современные ученые считают, что это могли быть просто гроздья фиников, тестикулы быков или даже части доспехов, в которые была облачена богиня. Как бы то ни было, у Линнея Артемида явно обладает четырьмя прекрасно сформированными молочными железами, что, вполне вероятно, можно принять за прямую аллюзию на самое замечательное открытие ученого: таксон млекопитающих. Ибо Линней сделал наличие молочных желез одной из отличительных характеристик того, чем мы являемся: членами огромного класса созданий, в который входят одновременно бурозубка-пигмей и голубой кит. Существует и третье возможное объяснение линнеевской Артемиды, возвращающее нас к тому, с чего мы начали, а именно, нашего отличия от остальных диких созданий. При описании вида Линней всегда действовал так же, как это делают таксономисты и в наши дни: перечислял признаки, отличающие представителей данного вида от других. Так он поступал в отношении всех видов, за исключением одного: нашего собственного. Когда дело дойдет до Homo sapiens, Линней вместо перечисления числа и категорий зубов, описания густоты волос или распределения сосков напишет только одно: "Познай самого себя" ("Nosce te ipsum"). В примечании он говорит, что эти слова Солона были начертаны золотыми буквами над входом в храм Дианы.[265] Возможно, выбрав Артемиду Эфесскую в качестве символического изображения для своей книги, он вспоминал и ассоциировал ее с этой характеристикой человеческого вида, самой краткой из всех возможных: познай самого себя. На этом, по существу, заканчивается линнеевское описание вида Homo sapiens. Он приводит еще несколько до странности назидательных высказываний, объясняющих смысл той новой идентичности, которую сам же только что нам и приписал. "Познай самого себя, – учит он, как Божье создание, наделенное разумом, дабы поклоняться Творцу; как самый совершенный и искусный механизм, повелитель животных и венец творенья". Все эти эпитеты звучат сегодня, как утверждения, давно потерявшие смысл. И все же в заключительном пассаже Линней сообщает нам нечто такое, что вполне можно использовать в качестве эпиграфа ко всему, написанному мною выше: Познай самого себя, как ты патологически слаб: хрупкий пузырек, подверженный тысячам случайностей. Если ты поймешь это, ты – человек и род, действительно отличный от других. Глава IX Умеренная жизнь [о старении] Луиджи Корнаро (1464-1566). Тинторетто. (Галерея Палатина) Хорея Гентингтона – один из самых тяжелых нейродегенеративных синдромов. Вначале болезнь обычно проявляется в виде незначительного психического расстройства и не кажется особенно серьезной. Но по мере прогрессирования заболевания психопатические приступы нарастают, увеличивается их число и степень тяжести. Ухудшается также координация движений, появляется характерная скованность в походке и жестах, которая в конечном итоге завершается параличом. В заключительной фазе болезни, для наступления которой требуется от десяти до двадцати лет, больные сходят с ума и страдают от нервных припадков. Один из них и приводит к летальному исходу. Это нарушение вызывается доминантными мутациями, выводящими из строя белок, участвующий в синаптических связях нейронов мозга. По причинам, пока еще не вполне понятным, мутантная форма белка запускает молекулярную программу, постепенно убивающую сами нейроны.[266] Болезнь Гентингтона имеет несколько странных особенности. Одна из них состоит в том, что симптомы заболевания приобретают из поколения в поколение все более тяжелую форму. Это явление носит название "антиципация" и определяется своеобразием соответствующего гена и вызывающих болезнь мутаций. Ген содержит участок, в котором три нуклеотида, ЦАГ, повторяются снова и снова. У большинства людей содержится от восьми до тридцати шести таких повторений. Приводящие к болезни Гентингтона мутации увеличивают число повторов, разрушая тем самым структуру белка. Некоторые подобные мутации наносят еще больший ущерб белку в ряду поколений что способствует увеличению тяжести заболевания. Другая особенность болезни связана с ее частотой. Она поражает одного из тысячи европейцев. Это очень высокий процент: большинство доминантных мутаций, приводящих к смертельному исходу, характеризуются частотой один на миллион. Но хорея Гентингтона может сохраняться в одной семье в течение многих поколений. В 1872 году Джордж Гентингтон, нью-йоркский врач, описал это нарушение, выраженное у представителей нескольких семейств с Лонг-Айленда, штат Нью-Йорк. Среди предков всех этих людей был некто Джефри Феррис, эмигрировавший из английского города Лейстер в 1634 году. Он почти наверняка страдал этой болезнью, как и многие из его потомков, живущих в наши дни. В Южной Африке около двухсот пациентов с болезнью Гентингтона ведут свое происхождение от Элсье Клутенс, дочери голландца, приехавшего с Яном ван Рибеком и основавшего Капскую колонию в 1652 году. Большая группа больных хореей Гентингтона живет в Венесуэле возле озера Маракаибо. Все они потомки одного немецкого матроса, который сошел здесь на берег в 1866 году.[267] Каким образом такое опасное, приводящее к летальному исходу заболевание может передаваться из поколения в поколение? В 1941 году британский генетик, блистательный и эксцентричный Дж.Б.С. Холдейн предложил ответ на этот вопрос. Он подчеркнул, что, в отличие от большинства генетических расстройств, симптомы болезни Гентингтона обычно проявляются только в зрелом возрасте. К этому времени большинство людей с дефектным геном уже имеют детей, каждый из которых может его унаследовать с 50-процентной вероятностью. В отличие от большинства летальных доминантных мутаций, убивающих своих жертв в раннем детстве и поэтому никогда не передающихся следующему поколению, мутация Гентингтона практически не влияет на репродуктивный успех ее носителей. Зрелый возраст для естественного отбора по существу невидим.[268] Найдется не много других нарушений, вызываемых единичной мутацией, которые оказывали бы такой разрушительный эффект в столь позднем периоде жизни. И все же необычность болезни Гентингтона обманчива, ибо разъяснение Холдейном причин ее распространенности помогает также понять, с небольшими допущениями, почему мы, как и большинство других животных, стареем. В данной главе я попробую доказать, что старение – это генетическое нарушение, или, скорее, комплекс генетических нарушений, одни из которых поражают всех нас без исключения, а другие – лишь некоторых особей. Эта точка зрения противоречит самой сути большинства определений болезни. Согласно медицинской традиции, существуют различия между "нормальным" старением, с которым ничего нельзя поделать, и "старческими" заболеваниями, такими как атеросклероз, рак и остеопороз, поглощающими огромные суммы из бюджета общественного здравоохранения. Однако различия эти иллюзорны. Они не более чем медицинская фикция, которая позволяет врачам не обращать внимания на болезнь, поражающую всех нас, ибо они не в состоянии ее вылечить или хотя бы облегчить. При правильном подходе старение является именно тем, чем оно и кажется: грозным, поражающим всех недугом. Бессилие отбора Старение есть присущее организму угасание. Самое очевидное его проявление – это возрастание частоты смертности параллельно тому, как мы стареем. Для восьмилетней девочки, живущей в одной из развитых стран, риск того, что она не увидит своего следующего дня рождения, составляет 1 к 5000. Для восьмидесятилетней женщины это соотношение 1 к 20. Конечно, можно лишиться жизни и от причин, вовсе не связанных со старением, например стать жертвой насилия, заразной болезни, несчастного случая, однако суммарный вклад этих факторов довольно незначителен. Не будь всеобъемлющего воздействия старения, 95 процентов из нас справляли бы свой сотый день рождения; половина людей на века обогнала бы по возрасту библейских патриархов и жила бы дольше тысячи лет. Многие смогли бы увидеть начало IV тысячелетия.[269] Эволюционное объяснение того, почему мы, а также большая часть других живых существ, стареем, базируется на двух доводах, скрытых в холдейновском объяснении частоты распространения заболевания. Первый состоит в том, что вредные последствия некоторых мутаций ощущаются лишь в поздние периоды жизни. Совершенно очевидно, что мутация может вызвать медленно прогрессирующее заболевание. Гентингтоновская мутация как раз и является такой бомбой с включенным часовым механизмом. Так же, как и мутация SOST, вызывающая склеростоз у белых жителей Южной Африки: дети от нее практически не страдают, но к зрелому возрасту чрезмерный рост костной ткани становится настоящим убийцей. Сходным образом действуют мутации гена BRCA1, семейного гена рака молочной железы, пагубные последствия которого обычно проявляются у женщин только в тридцати-сорокалетнем возрасте. Так же ведет себя и вариант гена АРОЕ, называемый ε-4, предрасполагающий пожилых людей к развитию инфарктов и болезни Альцгеймера. Список подобных примеров можно продолжить, но вместе с тем следует признать, что нам мало что известно о бомбах суперзамедленного действия,таких, которые детонируют после окончания периода зрелости и вызывают старение. Сейчас давайте просто предположим, что они существуют. Однако даже такого допущения недостаточно для объяснения старения. Необходимо также понять, каким образом эти мутации, выступающие в роли бомб с часовым механизмом, смогли стать неотъемлемой частью человеческой жизни. Холдейн предложил объяснение этому факту, сославшись на то, что мутация Гентингтона невидима для естественного отбора. Ту же самую логику он применил шире. Представим себе доминантную мутацию, которая делает двадцатилетнего мужчину импотентом на всю оставшуюся жизнь. В Британии, по крайней мере в XXI веке, довольно мало мужчин становятся отцами до двадцати лет, а после этого возраста жертва такой мутации уже никогда не сможет иметь детей. Каковы бы ни были его достижения в ходе дальнейшей жизни, с точки зрения сохранения генетической преемственности он вообще мог бы и не родиться. Такая мутация может встречаться много раз у многих мужчин, но, если не принимать во внимание отцов-подростков, передаваться следующим поколениям она не будет и поэтому навсегда останется редкой. Вообразите теперь другую доминантную мутацию, которая тоже делает своего носителя импотентом, но лишь по достижении им девяностолетнего возраста. Такой мужчина имеет превосходные шансы вообще не заметить потери своих мужских качеств по той простой причине, что, скорее всего, умрет раньше, став жертвой рака, инфаркта миокарда, гриппа или дорожного происшествия, если, скажем, не увидит приближающегося автобуса. Лежа в земле, о "виагре" не думают. Однако пока он был жив и считался здоровым мужчиной, у него появились дети, часть из которых унаследовала мутантный ген и передала его своим потомкам, а те – своим и так далее. Фактически вполне вероятно, что мутация, просто по воле случая, распространится по всей популяции, и через много поколений окажется, что все мужчины, дожившие до девяноста лет, импотенты, – по существу, так сегодня и происходит. Приведенные выше рассуждения попросту повторяют сказанное Холдейном о том, что сила естественного отбора по уничтожению вредной мутации ослабевает с течением жизни. Еще один британский ученый, сэр Питер Медавар, впервые применил этот принцип для объяснения причин того разнообразия способов, с помощью которых наши тела разрушаются в процессе старения. На поздних этапах онтогенеза одни мутации ухудшают функции сердечно-сосудистой системы, другие – способность противостоять раку и различным патогенным факторам, третьи ослабляют половые свойства, четвертые разрушают разум. Такие мутации замедленного действия всегда поражали человечество. Не подверженные действию естественного отбора, они широко распространились в популяции и сделались универсальными. Гипотеза Медавара относительно окончательных причин старения, конечно же, имеет много сильных сторон, но есть в ней одно слабое место: она не объясняет действия случая. Легко понять, почему мутации, вызывающие ряд тяжелых нарушений в старческом возрасте, не устраняются отбором, но достаточно ли этой причины для объяснения их повсеместного распространения в популяции? Возможно. Существуют, наверное, тысячи различных мутаций, оказывающих вредоносное воздействие на организм в конце жизни, причем каждая из них, должно быть, возникала бессчетное число раз в человеческой истории. Безусловно, можно предположить, что некоторые из них распространились случайно, в особенности в те времена, когда размеры человеческих популяций были небольшими. Но апеллировать к случайности – неблагодарная задача; мы предпочитаем детерминистскую теорию. В 1957 году одну из них выдвинул американский биолог-эволюционист Джордж Уильямс. По его утверждению, мутации, вызывающие старение, распространяются не по воле случая, а потому, что несут некоторые преимущества, хотя бы лишь молодым особям. Вообразите еще раз мутацию, которая приводит к импотенции в девяностолетнем возрасте, но зато обеспечивает необычайную плодовитость двадцатилетним. Носитель такой мутации наверняка обгонит других мужчин по числу детей, что обеспечит широкое распространение мутантного гена. В калькуляциях естественного отбора небольшие преимущества, проявляющиеся на ранних стадиях развития особи, часто перевешивают жестокие издержки, которыми приходится расплачиваться позже. Пожилой возраст с этой точки зрения есть та цена, которую мы платим за чрезмерную красоту и буйные излишества юности. Некоторые генетики воспользовались логикой подобных рассуждений для объяснения широкого распространения хореи Гентингтона. Они утверждают, что женщины с таким заболеванием на ранних стадиях его развития отличаются чрезвычайной неразборчивостью в связях, или уступчивостью, или, по крайней мере, необычайной плодовитостью. В одном исследовании было показано, что женщины с болезнью Гентингтона имеют больше детей, рожденных вне брака, чем их здоровые сестры. Возможно, продолжают ученые в развитие своей аргументации, болезнь вызывается необычно высоким содержанием гонадотропина, гормона, определяющего половое поведение. Однако в поддержку этой точки зрения почти нет доказательств.[270] Вообще говоря, о генах, вызывающих старение у человека, известно так мало, что трудно понять, которая из точек зрения – Медавара или Уильямса – является более правильной. В каком-то смысле различия между двумя теориями на самом деле не важны; обе они могут оказаться верными, поскольку выявляют сходные причины и последствия явлений. Обе теории утверждают, что старение происходит не просто так, а является побочным продуктом эволюции. В конечном итоге оно развивается вследствие неспособности естественного отбора противостоять мутациям, вызывающим заболевания у стариков. Ни одна из теорий подробно не разъясняет молекулярные причины старения или их механизмы. Они не говорят о каком-либо одном молекулярном механизме, который можно было бы отрегулировать, обеспечив тем самым наше с вами бессмертие. Скорее обе теории приходят к выводу о невозможности обнаружения подобного механизма, подразумевая под этим, что процесс старения является совокупным последствием множества различных мутаций, постепенно изнашивающих и в конечном итоге разрушающих наш организм.[271] Возможно, поэтому, несмотря на массу предпринятых усилий, механистические причины старения до сих пор остаются нераспознанными. Время от времени корнем зла становится любой из десятков факторов биологии человека. По утверждению одних, старение обусловлено ферментацией бактерий в нашем кишечнике; по мнению других – снижением скорости клеточного деления; третьи во всем винят тяготы вынашивания и выращивания потомства. Есть и такие, кто считает старение последствием истощения некоей жизненной энергии, или накопления химических веществ, которые производятся клетками и в конце концов отравляют нас. Некоторые из этих идей наверняка абсурдны, однако в других определенно содержится какое-то зерно истины. Ниже следует обзор наиболее убедительных теорий: краткая история распада. Геронтократы На закате своих дней, купаясь в богатстве и славе после изобретения телефона, Александр Грэм Белл обратил свое внимание на генетику. Его первые попытки на новом поприще были довольно скромными. Он вывел породу овец с четырьмя сосками вместо обычных двух. Затем, сочетая свой интерес к звуку с увлечением генетикой, занялся изучением наследования глухоты. Однако его страстью была генетика долгожительства. Он начал с семейства одного из американских отцов-пилигримов, некоего Уильяма Хайда (который обосновался в Нориче, штат Коннектикут, в 1660 году). Все его потомки, общим числом 8797 человек, были отслежены составителями родословных. Анализируя эти записи, Белл пришел к заключению, что тенденция к долгожительству в основном наследуется. Ни его данные, ни статистика не подтверждали этот вывод. Но в целом он оказался прав: по современным оценкам, наследственность определяет долгожительство у европейцев на 20-50 процентов. В тот момент этих изысканий было достаточно, чтобы Белл приступил к реализации куда более грандиозных прожектов.[272] Подобно многим другим ученым умам начала XX столетия, Белл с энтузиазмом относился к евгенике, конечно, не к "негативной" ее ветви, которая опиралась на государственные программы стерилизации умственно отсталых и антиобщественных элементов и вошла в моду в 1920-е годы. Для Белла подобный подход был недопустим: он был гуманным человеком, и не случайно первое американское общество глухих носит его имя. Его отношение к евгенике было "позитивным", либеральным и в значительной мере предпринимательским: по его мнению, евгеника могла оказаться полезной на рынке человеческих эмоций. Белл сперва выступил с предложением, а затем сам начал собирать обширные материалы о продолжительности жизни населения, используя для этого школы столичного города Вашингтона, федеральный округ Колумбия. Его метод заключался в том, чтобы опрашивать учащихся о возрасте их родителей, а также бабушек и дедушек. Затем он опубликовал материалы опроса вместе с именами и адресами интервьюируемых в солидном томе, который назвал безо всяких экивоков "племенной книгой человека". Он считал, что люди наверняка станут обращаться к его книге и что потомки семей долгожителей, получив нужные сведения, будут отыскивать друг друга, влюбляться и размножаться. А что же станут делать потомки людей, жизнь которых рано оборвалась? Может, они просто не будут вступать в брак? Или, возможно, долгожители и те, кто рано умирает, разделятся на две отчетливые расы, что приведет к формированию истинной геронтократии. Генетический прогресс, как и прогресс экономический, нуждается в эффективных рынках, а для создания эффективных рынков нужна информация – все это было для Белла слишком очевидно. План Александра Грэма Белла был визионерским и слегка безумным. (Кто из нас станет выбирать предмет мечтаний на основе средней продолжительности жизни его или ее дедушек и бабушек?) Неудивительно, что он рухнул вместе со смертью Белла в 1922 году. И все же, если бы план получил широкое распространение и нашлись бы люди, готовые поступать так, как на то рассчитывал Белл, результаты оказались бы впечатляющими. Без сомнения, тщательная селекция семей долгожителей привела бы к появлению линий долго живущих людей. Возможно, они все же не достигли бы возраста библейских патриархов, но уж точно жили бы дольше тех семидесяти с лишним лет, на которые все мы имеем некоторые основания рассчитывать. Мы можем так рассуждать, потому что экспериментальные программы, сходные с той, что предлагал Белл, дают хорошие результаты на животных. В 1980-х годах эволюционный подход к старению, предложенный Уильямсом и Медаваром, вдохновил исследователей на попытку создания линии долго живущих плодовых мушек. Если окончательная причина старения лежит в исключении влияния естественного отбора на поздних этапах жизни, рассуждали ученые, то, вероятно, мушек-долгожителей можно вывести, заставив естественный отбор воздействовать на старых мух. Плодовая мушка начинает размножаться в двухнедельном возрасте, едва вылупившись из куколки, но по прошествии десяти недель она окончательно стареет, достигая, по нашим масштабам, восьмидесятилетнего возраста. Самцы плодовых мушек вообще никогда не доживают до такого возраста, а отдельные самки – твердые орешки, которые все же достигают этого рубежа, – характеризуются полным истощением метаболических резервов, оборванными крыльями и слабенькими ножками. Однако они все-таки способны отложить хотя бы несколько яиц. Так, поколение за поколением, только из яиц старых самок были выведены новые популяции плодовых мушек. В результате эксперимента были созданы благоприятные условия для тех генетических полиморфных систем, которые способствовали выживанию и сохранению плодовитости в старческом возрасте. По мере увеличения частот этих полиморфизмов продолжительность жизни мух возрастала. Скорость происходящих процессов была совершенно поразительной. Десяти поколений селекционно выведенных мух оказалось достаточно, чтобы средняя продолжительность жизни возросла на 30 процентов, что по человеческим меркам эквивалентно увеличению ожидаемой средней продолжительности жизни с семидесяти восьми лет до ста с лишним. Через пятьдесят поколений под действием отбора продолжительность жизни мух удвоилась. При более внимательном обследовании этих мушек-долгожителей выяснилась их поразительная жизнестойкость. Они выживали в отсутствие воды и пищи, под воздействием вредных химикатов, тогда как их родственники из недолго живущих линий в тех же условиях быстро погибали. Однако за торжество в старости они платили дорогую цену. По мере роста продолжительности жизни плодовитость мушек на ранних стадиях онтогенеза снижалась. Самки откладывали меньше яиц, самцы не проявляли большой склонности к спариванию. Избегая излишеств, плодовые мушки из долгожительских линий скапливали свои ресурсы и запасались резервами жиров и сахаров. Они становились вялыми и неторопливыми; скорость движений, дыхания и обменных процессов у них была медленнее, чем у обычных мух.[273] Этот результат совпадал с предсказаниями теории Джорджа Уильямса. Если старение есть генетическая расплата за ранний репродуктивный успех, тогда справедливо и обратное, а именно то, что жизнь можно продлить, заплатив за нее отказом от юношеских утех. Так выражается простое экономическое соотношение между плодовитостью и продолжительностью жизни. У мухи есть некоторое количество ресурсов: она может потратить их на то, чтобы жить долго, или израсходовать на потомство. Сделать и то и другое она не в состоянии. Эта цепь рассуждений приводит нас к Аристотелю. При описании физиологии животных он высказал предположение, что животным для жизни требуется "влажность" и что она имеется у них в ограниченном количестве: жизнь – это теплота и влажность, а смерть – холод и сухость. "Вот почему, – пишет он, – животные, которые часто совокупляются и производят много семени, рано стареют; семени остается все меньше, дальше оно исчезает, и наступает сухость".[274] Со времен Аристотеля многочисленные исследователи подтвердили, что процесс воспроизводства у самых разнообразных существ является ценой выживания. Насколько тяжелой может быть эта плата в своем предельном выражении, демонстрируют австралийские сумчатые мыши Antechinus stuarti. Для самцов этого вида мышей существование по сути приравнено к сексу. Их короткая взрослая жизнь состоит из драк с другими самцами, блужданий в поисках самок и, после обнаружения последних, участия в изнурительных спариваниях, которые длятся по двенадцать часов и повторяются ежедневно в течение практически двух недель. Наверное, совсем неудивительно, что после одного-единственного брачного сезона самцы умирают, при этом все их ткани несут на себе признаки катастрофического старения. К моменту завершения своих обязанностей у них отсутствует сперма, предстательные железы ссыхаются, яички зарастают соединительной тканью, надпочечники гипертрофируются, печень некротизируется, желудочно-кишечный тракт кровоточит, половой член становится дряблым.[275] Сумчатых мышей можно считать крайне выразительной иллюстрацией утверждения, что старение есть следствие юношеских эксцессов. Но есть доказательства, что тот же самый экономический принцип приложим и к людям, хотя и в гораздо меньшей степени. У британцев, конечно, нет отцов-пилигримов для построения генеалогий. Зато у них есть аристократия, ведущая начало в основном со времен норманнов, единственное, и по существу определяющее, достоинство которой состоит в одержимости своей родословной. По традиции, генеалогии британских знатных домов записываются в многотомную "Книгу пэров" Берка, но в наши дни можно получить более удобный свод родословных большинства британских пэров, начиная с герцогов и графов Аберкорн и кончая баронами Уиллоби де Брук, записанный на CD-ROM. Эта база данных, идущая в глубь веков до 740 года н.э., содержит информацию, если таковая имеется, о датах рождений, заключения браков и всех наследниках британских благородных семейств. С ее помощью можно проверить идею, очевидную для родителей любого только что появившегося на свет младенца, что рождение детей сокращает годы вашей жизни. До промышленной революции жена британского аристократа могла рассчитывать прожить до сорока пяти лет. Она могла также рассчитывать родить двоих или троих детей. Эти усредненные цифры, однако, скрывают массу разнообразных случайностей. Некоторые женщины умирали молодыми и рожали очень мало детей. Другие умирали через десять или двадцать лет после наступления менопаузы (между пятьюдесятью и шестьюдесятью годами); они в среднем имели 2,4 ребенка. Но были и такие, хоть и очень редко, кто жил до девяноста лет и дольше. У этих пожилых леди средняя плодовитость составляла 1,8 ребенка, причем почти половина из них вообще были бездетными.[276] Это поразительный результат. Он не только совпадает с итогами экспериментов на плодовых мушках, но и наводит на мысль о том, что если бы мечты Александра Грэма Белла как-то осуществились, у его геронтократов была бы совсем низкая плодовитость. Более здравое рассуждение состоит в том, что многие, хотя, конечно, далеко не все, признаки старческой деградации в поздние годы жизни трудно выправить, не отказавшись от физиологических и сексуальных излишеств юности. В будущем люди смогут себя проектировать и с помощью то ли улучшенных медицинских препаратов, то ли улучшенных генов жить столько, сколько им заблагорассудится. Однако ценой этой долгой жизни станут поколения двадцатилетних, которые, лишившись своей энергии, привычек и шарма, будут неотличимы от пожилых.[277] La vita sobria[278] Существует ли рецепт долгой жизни? Луиджи Корнаро полагал, что да. В 1550 году венецианский аристократ опубликовал трактат под названием "Рассуждения об умеренной жизни", в котором он описал привычки, обеспечившие ему долгую жизнь. В то время ему было, вероятно, восемьдесят три года, а прожил он либо до девяноста восьми, либо до ста трех лет – есть некоторые разногласия по поводу даты его рождения, но все сходятся во мнении, что дожил он до глубокой старости. По его собственным словам, до сорока лет он вел беспутный образ жизни, следствием которого были боли в желудке и в боку, подагра, лихорадка и неутолимая жажда. Врачи предупреждали его, что надо либо перемениться, либо готовиться к смерти. Он всерьез отнесся к их советам и целиком посвятил себя размеренному и упорядоченному образу жизни. Основной принцип его новой системы был прост: мало есть и только такую пищу, которую он считал подходящей. "Не пресыщать себя пищей – и есть правило здоровья", – писал он. Корнаро почти не входит в детали, но в одном месте он излагает подробности своей диеты, и она не кажется слишком аскетичной. Обычная еда начинается с хлеба, за которым следует некрепкий бульон, можно с яйцом. Но, добавляет он "я также ем телятину, мясо козленка, баранину; я ем всякую дичь, а также куропаток и птиц вроде дроздов. Я также употребляю в пищу морскую рыбу, такую как карась или дорада и подобные им; среди различных пресноводных пород – щуку и других". Ничего не скажешь – скромная диета по масштабам итальянских застолий XVI века. Тем не менее в какой-то момент он сделался настолько худым, что друзья заставляли его есть больше. Корнаро отвечал им с мудростью оракула: кто желает есть долго, должен есть мало. Несмотря на некоторое самолюбование, книга Корнаро очаровывает, ибо он получает столь явное удовольствие от своей долгой жизни. На портрете Тинторетто он изображен во всем великолепии старческой немощи – суровый патриций с тонкими чертами лица и просвечивающей от возраста кожей. Последние годы жизни Корнаро провел в собственном падуанском палаццо с росписями Рафаэля и на вилле в Эвганских горах возле реки Бренты в окружении изысканных садов и фонтанов. "Я не знал, – пишет он, – что мир может быть столь прекрасным, покуда не состарился". "Умеренная жизнь" имела огромный успех. По мере того как он старел, Корнаро добавлял все новые материалы к последующим изданиям книги: два, три и, наконец, четыре новых рассуждения. Продукт итальянского Ренессанса, книга по стилю была классической (Якоб Буркхардт писал о ее совершенстве), по рассуждениям о физиологии – аристотелевской (в ней много говорится о потере влажности), по настроению сходна с мыслями Цицерона (старость – это желанный возраст, время мудрости, когда все страсти улеглись и перегорели). Она оказала длительное воздействие на последующую литературу. Отголоски этой книги можно найти, например, в текстах немецкого врача Кристофа Гуфеланда, чей труд "Макробиотика" (1796) обосновал теорию, к которой восходят все современные рекомендации по поводу здорового питания.[279] Хуже всего то, что Корнаро оказался отчасти прав, утверждая, будто долго жить значит меньше есть. Под этим я подразумеваю не просто такую диету, которая предотвратила бы развитие ожирения или даже старения, а серьезное ограничение питания, которое могут добровольно выдерживать лишь очень немногие люди. Единственный надежный способ продлить общее физиологическое существование млекопитающего – это давать ему не более двух третей ежедневного количества требуемых калорий. В десятках исследований показано, что "калорийно ограниченная" диета на 10-50 процентов продлевает жизнь мышей по сравнению с теми животными, которые могут есть столько, сколько хотят. В каждой возрастной группе экспериментальные особи отличаются большей подвижностью, гладкой блестящей шерсткой и лучшим состоянием здоровья от контрольных животных. Кроме того, они намного худее и весят примерно в два раза меньше контрольной группы. Конечно, мыши, сидящие на калорийно ограниченной диете, в конце концов тоже умирают, но возраст, в котором у них происходит развитие диабета, инфекционных заболеваний, почечной недостаточности, аутоиммунных процессов, мышечно-скелетных нарушений, кардиомиопатии, нервных расстройств и, что всего удивительнее, рака, при этом значительно отодвигается. Сейчас подобные исследования проводятся на макаках резусах, чтобы выяснить, приведет ли ограничение калорий к удлинению жизни у приматов. Однако пройдет не менее десяти лет, прежде чем будет известен ответ. Эта неопределенность не останавливает многих неокорнарианцев, и они решительно посвящают свою жизнь строжайшему соблюдению диеты. Ограничение калорий в питании стало одним из модных течений по сохранению здоровья и, подобно многим другим, имеет свои издания и своих гуру. Диета должна насчитывать примерно тысячу калорий в день, к которым обычно добавляется набор витаминов и микроэлементов. Тысяча калорий – это минимум, необходимый для поддержания жизни мужчине среднего роста, хотя едва ли достаточный для удовлетворения полового влечения (или, если судить по фотографиям, для сохранения сексуальной привлекательности). Вопрос о том, добьются ли эти ультра пуритане своего конечного вознаграждения, остается открытым. Крайняя степень калорийного ограничения, испытанная населением Голландии во время голодной зимы 1944-1945 годов, явно не оказала положительного эффекта на долгосрочные показатели смертности тех, кто ее пережил. Но здесь нам могут возразить, заметив, что нужны десятилетия практически голодной диеты для того, чтобы оценить ее преимущества.[280] Калорийное ограничение дает хорошие результаты у крыс, мышей, плодовых мушек и червей-нематод. Почему так происходит, остается загадкой. Одно из объяснений возвращает нас к вредным воздействиям размножения. Животные, питающиеся с ограничением калорий, имеют меньше потомков, чем те, которые едят столько, сколько захотят. Возможно, те энергетические запасы, которые не расходуются из-за сокращения процесса воспроизводства, достаточны для обеспечения большей продолжительности жизни. Но, наверное, во всем этом есть и другой смысл. У плодовых мушек, питающихся с ограничением калорий, гены, ответственные за размножение, в основном отключены. Помимо этого, происходит включение генов, отвечающих за сопротивление инфекциям (иммунной системы мушек), что приводит к повышению производства иммунных белков по сравнению с обычным уровнем. Эти результаты объясняют по крайней мере две причины увеличения продолжительности жизни у животных с ограниченно калорийной диетой. Кроме них возможны десятки других объяснений. Около двух тысяч генов из пятнадцати тысяч генома мухи демонстрируют реакцию на калорийное ограничение. Вполне возможно, что магическое воздействие калорийного ограничения достигается за счет аккумулирования преимуществ десятков отдельных молекулярных механизмов.[281] Этому вряд ли приходится удивляться. Эволюционная теория предполагает, что старение вызывается независимыми разрушениями в ряде различных систем. Если калорийное ограничение оказывает такое всепроникающее воздействие на организм, то и оно тоже должно способствовать поддержанию здоровья десятками самых разных способов. И все же некоторые геронтологи до сих пор ищут одно-единственное объяснение для всех разнообразных проявлений старения и того механизма, с помощью которого происходит их задержка при калорийном ограничении. Одно из предположений состоит в том, что старение развивается вследствие некоего скрытого отравления организма, причина которого заключена в самом существовании живого. Дыхание смерти "Мы именуем сон смертью, и все же убивает нас именно пробуждение", – заметил Томас Браун в "Религии медика". Мысль о том, что жизнь сама по себе есть причина нашего увядания – либо вследствие истощения некоего жизненного вещества, либо за счет постоянного самоотравления, – одна из самых древних в истории науки о старении. Новейшая интерпретация этой истины гласит, что старение вызывается крошечными вредоносными молекулами, способными окислять ДНК, белки, липиды – то есть практически все, с чем они контактируют. В ходе нормального дыхания кислород превращается в воду. Но этот процесс несовершенен, и в качестве побочных его продуктов образуется несколько разновидностей молекул, именуемых свободными радикалами. Эти молекулы, имеющие химическую формулу, например •OH (где • означает непарный электрон), особенно обильно представлены в митохондриях, субклеточных структурах, в которых и осуществляется процесс дыхания. Оттуда они проникают в остальную часть клетки, атакуя по пути другие структуры. Теория свободных радикалов утверждает, что старение обусловлено накоплением тех повреждений, которые в течение многих лет наносят клеткам эти молекулы. Эта точка зрения подтверждается обилием соответствующих доказательств. Свободные радикалы, несомненно, повреждают клетку, и спектр этих повреждений по мере старения становится все более обычным. Опаснее всего то, что они вызывают мутации. ДНК каждой человеческой клетки за день получает до десяти тысяч окислительных повреждений. Часть из них компенсируется, а другие – нет. У старых крыс в одной клетке происходит около двух миллионов мутаций – вдвое больше, чем у молодых особей. Большая часть этих мутаций не оказывает воздействия на благополучие данной клетки. Но если радикал поражает ген, жизненно необходимый для существования клетки, это может ее убить. Если, допустим, пораженным оказывается ген контроля за пролиферацией в зародышевой клетке, может начаться рак. Если ущерб будет нанесен гену в тех клетках, из которых образуются спермии и яйцеклетки, повреждение будет передано будущим поколениям.[282] Свободные радикалы явно вредоносны. Но действительно ли они являются причиной старения – хотя бы отчасти или полностью? Возможно, да. Животные-долгожители, родились ли они такими или сделались под действием калорийного ограничения, исключительно устойчивы к токсическим веществам, наподобие гербицидов, которые употребляются для борьбы с сорняками и вызывают появление свободных радикалов в организме. Более веские доказательства получены в ходе генетических манипуляций с разнообразными животными. Клетки животных содержат целый набор защитных механизмов против свободных радикалов, в том числе группу антиоксидантных ферментов, предназначенных для их уничтожения, например супероксиддисмутазу (superoxide disvutase – SOD). Ряд различных доказательств подтверждает, что эти ферменты способны предотвратить некоторые из проявлений старения. Особенно активная форма супероксиддисмутазы как будто способствует удлинению жизни плодовых мушек, что возвращает нас к предыдущим результатам воспроизводства поколений геронтократов. Исходная популяция мушек в этих экспериментах была полиморфной по двум разновидностям супероксиддисмутазы. Отбор изменил частоты встречаемости этих вариантов, так что более активная форма стала намного более распространенной в популяциях мух-долгожителей по сравнению с их мало живущими родственниками. Это не было делом случая: эксперимент повторяли пять раз, и каждый раз результат был один. Еще более очевидные доказательства преимуществ этого фермента были продемонстрированы в экспериментах по генетическому инжинирингу, когда в двигательных нейронах мух была экспрессирована человеческая супероксиддисмутаза, несомненно намного более мощная по сравнению с мушиной. Эти мухи жили на 40 процентов дольше контрольных, не подвергшихся генетическим изменениям. Особый интерес эти эксперименты вызывают еще и тем, что указывают на способность супероксиддисмутазы защитить нервную систему. Наконец, в последние несколько лет у червей нематод и плодовых мушек были обнаружены мутанты, по-видимому наделенные свойствами к редкостному долгожительству (один из таких мутантов даже был наречен Мафусаилом, по имени библейского патриарха, который, по утверждению Книги Бытия, жил до 969 лет). У этих мутантов не изменяются последовательности самих генов супероксиддисмутазы, но, скорее, затрагиваются гены, которые отвечают за то, когда и как происходит процесс активации супероксиддисмутазы. По-видимому, трудно получить долго живущую мушку или червя без того, чтобы тем или иным способом не задействовать супероксиддисмутазу. Все эти результаты позволяют выстроить следующую цепь аргументов: экстра-супероксиддисмутаза задерживает старение (по крайней мере у червей и мух); супероксиддисмутаза защищает организм от свободных радикалов; следовательно, свободные радикалы вызывают старение. Значит ли это, что способы по предотвращению собственного старения уже находятся у людей под рукой? Может, нам просто нужно сконструировать в себе более эффективный вариант супероксиддисмутазы и тем продлить годы жизни? Короткий ответ на этот вопрос оказывается отрицательным. Более того, после разъяснения причин, почему такой путь невозможен, возникают сомнения и в отношении всех предшествующих рассуждений.[283] В наших геномах содержатся три гена, кодирующие супероксиддисмутазу. Мутации одного из них, SOD1, были известны давно. Это мутации утраты функции доминантного типа: они приводят к появлению гиперактивного белка. Казалось бы, именно эти мутации, по аналогии с плодовыми мушками и червями, и дадут человеку возможность жить до ста двадцати лет. На самом деле они убивают своих носителей лет в пятьдесят или около того. Мутации SOD1 вызывают боковой амиотрофический склероз (БАС), чрезвычайно тяжелое неврологическое заболевание, при котором происходит прогрессирующее разрушение двигательных нейронов спинного мозга, ствола мозга и двигательной коры, приводящее к параличу и смерти. В Америке эта болезнь носит имя Лу Герига, игрока в бейсбол, который страдал ею и от нее умер. Ни при каком другом заболевании вопрос об эвтаназии от руки врача не стоит с такой остротой, как при БАС.[284] Эти мутации ставят нас в тупик. Они означают, что супероксиддисмутаза убивает мотонейроны у человека, но предохраняет их у мушек. Почему? За последние десять лет загадка была разрешена примерно следующим образом. Супероксиддисмутаза – всего лишь первый шаг на пути ферментативной нейтрализации свободных радикалов. Она превращает свободный радикал аниона кислорода, O•2, в другую молекулу Н2О2, более известную как перекись водорода, о разрушительном воздействии которой на биологические ткани можно судить по ее активной роли в процессе химчистки и при окрашивании волос в классический убийственный платиновый цвет. Для нейтрализации перекиси водорода и превращения ее в воду нужен еще один фермент – каталаза. Возможно, несбалансированность в активности этих двух ферментов вызывает у людей, но не у мух, накопление перекиси водорода в нейронах, что и приводит к их гибели. Это разумное объяснение оказывается совершенно ошибочным.[285] Причина, по которой мутации SOD1 убивают мотонейроны, не имеет ничего общего ни со свободными радикалами, ни с отравлением перекисью водорода. Скорее их вредоносный эффект может быть связан с другой, слегка загадочной, ролью супероксиддисмутазы, которую она играет в мозге. Нейроны – странные клетки. Они большие, с длинными выступающими отростками, которые называются аксонами, и весьма специфичной клеточной архитектурой, которая при этом присутствует. Супероксиддисмутаза, помимо поглощения свободных радикалов, по-видимому, выполняет также определенную роль в создании этой архитектуры. Биологи позаимствовали симпатичное выражение для обозначения таких многопрофильных белков – они называют их "совместителями". Совместительство SOD1 может вызывать также еще одно неврологическое заболевание – синдром Дауна. У детей с синдромом Дауна имеется три копии 21-й хромосомы вместо обычных двух. Это та самая хромосома, на которой располагается ген SOD1. Сотни различных генов располагаются на этой же хромосоме, и любой из них может вызывать отчетливые проявления болезни Дауна (умственную отсталость, аномальные черты лица, проблемы с сердцем – мы перечислили лишь некоторые), однако именно лишняя копия SOD1 уже давно отнесена к разряду наиболее вредоносных.[286] Если супероксиддисмутаза действительно "работает по совместительству", тогда приведенные выше рассуждения основаны на ложных предпосылках. А значит, отпадает одна из немногочисленных веских причин верить в то, что старение происходит из-за свободных радикалов. Сторонники этой теории (а среди ученых их наверняка найдется несколько тысяч) вполне могут считать, что это слишком жесткая оценка для объяснения одного из механизмов возникновения старения, который все же имеет хоть какие-то основания для более широких обобщений. Конечно, не исключена возможность, что кажущееся благоприятное влияние супероксиддисмутазы на увеличение продолжительности жизни целиком связано с уничтожением свободных радикалов, но это еще надо как следует доказать. В настоящее время, однако, найдется мало несогласных с тем, что супероксиддисмутаза должна быть вычеркнута из списка эликсиров, которые могут однажды приостановить наступление нашей старческой немощи. Морщины Даже если свободные радикалы служат не единственным и вовсе не главным источником мутаций, последние все же порождают, по крайней мере некоторые, характерные признаки старения. Мутации могут быть особенно разрушительными в таких тканях, как кожа, клетки которой делятся постоянно в течение жизни. Некоторые из нас сохраняют относительно моложавую внешность вплоть до глубокой старости, другие, будучи совсем молодыми, покрываются морщинами. Эти различия отчасти обусловлены воздействием на кожу атмосферных факторов, в первую очередь солнечного света, который получает каждый из нас, поскольку ультрафиолетовые лучи – мощный мутаген. Но даже защищенная от солнца кожа стареет. И сколько бы зонтиков, вуалей и защитных кремов мы ни использовали, кожа в тридцать пять лет никогда не будет такой сверкающей и гладкой, какой она была в пятнадцать. Появление морщин – это признак глубинной неспособности клеток эпидермиса к замещению и поддержанию целостности соединительной ткани слоев кожи. Эта проблема касается всего нашего организма. Ее с очевидностью демонстрируют люди, кожа и соединительные ткани которых стареют с необыкновенной, можно сказать катастрофической, скоростью. Жертвы наследственного заболевания, именуемого синдромом Вернера, вынуждены седеть и лысеть еще в подростковом возрасте. В двадцать с небольшим лет у мужчин атрофируются яички, а у женщин – фолликулы яичников, что приводит к специфической преждевременной менопаузе. На четвертом десятке больные нуждаются в трансплантации хрусталика для лечения катаракты, а их артерии отвердевают и покрываются жировыми отложениями. В сорок с лишним они умирают, обычно от инфаркта.[287] Синдром Вернера входит в группу наследственно обусловленных заболеваний ускоренного старения, объединенных под общим названием "прогерия". Сам синдром вызывается мутациями, которые выводят из строя белок, поддерживающий целостность ДНК во время репликации. В отсутствие этого протеина в клетках развивается очень высокая скорость мутаций. Мутационный обвал приводит к гибели, а не пролиферации клеток, или даже к продуцированию аномальных белков. Ткани, которые для сохранения целостности зависят от наличия большого количества делящихся клеток, такие, например, как кожа, деградируют. Возможно, нечто подобное происходит со всеми нами, только значительно медленнее. По мере старения жизненная сила уходит из наших клеток. Это можно продемонстрировать в лаборатории. Давно известно, что с помощью сложных и тонких методов можно выращивать человеческие клетки в чашках Петри. Однако вне зависимости от качества условий окружающей среды, сколь бы благоприятными они ни были, свежевыращенные клетки будут делиться лишь ограниченное число раз, а затем прекратят деление. Их упадок происходит постепенно и вызывается некоторыми внутренними ограничениями. По мнению многих, клеточное старение есть не просто следствие старения организма, а его непосредственная причина. В подтверждение этой идеи клетки, взятые от плодов человека, прежде чем погибнуть, способны делиться на протяжении вдвое большего числа поколений по сравнению с теми, которые получены от девяностолетних стариков. Тогда, наверное, у пожилых людей множество клеток приближаются к завершению своей репликационной карьеры и в силу этого не могут больше компенсировать получаемые ущербы и дефекты, как они это делали раньше. Поэтому, когда в 1998 году были обнаружены молекулярные причины ограничения клеточных делений и барьеры эти впоследствии были преодолены, все пришли в волнение. Если можно вылечить клеточное старение, значит, вероятно, и саму старость. Всякий раз, когда клетка делится, должны удваиваться и ее хромосомы. Но ферменты, участвующие в репликации ДНК хромосом, не способны удваивать концы хромосом. Поэтому эти концы, защищенные последовательностями длиной в тысячи пар оснований и называемые теломерами, постепенно укорачиваются в процессе многих клеточных делений со скоростью около ста пар оснований на одно деление. Если теломеры исчезают, клетки больше не могут делиться и умирают. Именно скорость исчезновения теломеров лежит в основе фундаментального механизма старения. По крайней мере, так это выглядит сегодня. В таком случае необходимо найти способ по предотвращению изнашивания теломеров. Далеко не все клетки расстаются со своими теломерами. Зародышевые клетки, производящие яйцеклетки и спермии, обладают сложным ферментом, так называемой теломеразой, которая сохраняет теломеры, обеспечивая тем самым столь необходимое для этих клеток бессмертие. Утрата теломеров всеми остальными клетками тела происходит как раз оттого, что они не содержат этого фермента. Если путем инжиниринга внедрить теломеразу в клетки, которые обычно ее не имеют, то в процессе множества делений теломеры будут сохранены, и клетки обретут бессмертие.[288] Если дорога к клеточному бессмертию столь проста, почему бы нам ею не воспользоваться? Причина довольно банальна: бесконечность – это свойство рака. Почти все опухолевые клетки на какой-то стадии своего существования перенесли мутацию, вызвавшую у них появление теломеразы, которая у здоровых клеток не присутствует. Отсутствие теломеразы в наших клетках – это, вероятно, один из основных защитных механизмов, которым мы располагаем против размножения чужеродных клеток. Кроме того, пока еще совсем неясно, что укорочение теломеров действительно вызывает старение. Только в одном из экспериментов эта проблема решалась напрямую: когда мыши с дефектом теломеразы были вначале выведены с помощью генной инженерии, а затем размножались в течение шести поколений.[289] Мыши, судя по всему, вполне могут обходиться без теломеразы, по крайней мере – в течение некоторого времени. Первое поколение дефектных по теломеразе мышей, когда оно было получено, не проявляло никаких признаков преждевременного старения. Некоторым образом, в этом не было ничего удивительного. У этих мышей теломеры были столь же длинными, как и у всех остальных, поскольку мыши, подобно людям, наследуют свои теломеры от родителей, а их родители были в этом отношении нормальными. Однако потребность в теломеразе со стороны зародышевых клеток приводила к тому, что каждое последующее поколение мутантных мышей вступало в жизнь со все более короткими теломерами. Эффект проявился у четвертого поколения мышей, когда у самцов значительно сократилось количество живых спермиев. К шестому поколению они вообще исчезли. Самки не сделались стерильными, но стали продуцировать меньше яйцеклеток, чем обычно; к тому же из этих производимых ими яйцеклеток часто развивались дефектные эмбрионы. К шестому поколению и самцы и самки начали преждевременно стареть. Как и люди, мыши с возрастом лысеют и седеют. Так случилось с мышами шестого поколения, пока они были еще совсем юными. Эти результаты в лучшем случае могут служить подтверждением, хотя и неоднозначным, того положения, что потребность в теломерах является причиной старения. Достаточно короткие теломеры определенно могут вызывать преждевременное старение, но поскольку это происходит только у животных шестого поколения после их изнашивания, они не могут считаться причиной нормального старения у мышей. Весьма соблазнительно отказаться от укорочения теломеров как причины, объясняющей старение также и у людей, но, вероятно, делать это пока рано. У лабораторных мышей исключительно длинные теломеры – куда длиннее, чем у нас. Если наши теломеры в самом начале человеческой жизни уже достаточно коротки и должны, за счет наших крупных размеров и долгой жизни, расходоваться гораздо интенсивнее, чем у мышей, тогда сохраняется вероятность, что они все же кое-что значат и для нас.[290] Одним из способов доказать это утверждение может стать клонирование человека. Клоны должны вступать в жизнь с аномально короткими теломерами, поскольку они появляются на свет без помощи зародышевых клеток и, следовательно, их теломеры никогда не возобновляются. Последовательные поколения клонов должны обладать постоянно укорачивающимися теломерами, а скорость их старения должна стремительно возрастать, тем более в том случае, если донорский организм не был молодым. Глобальный запрет на клонирование человека не позволяет рассчитывать на скорое проведение такого эксперимента – разве что на это решатся одержимые уфологи или итальянские отступники-акушеры. Но, разумеется, есть данные, полученные на животных. Овечка 6LL3, известная по кличке Долли, получила свои хромосомы из клеток молочных желез шестилетней овцы финско-дорсетской породы. По этой причине она начала свою жизнь с довольно-таки короткими теломерами. Многие считали, что она будет рано стареть. Однако, если не считать кое-какого артрита, она оставалась вполне здоровой. В вирусном заболевании, которое ускорило ее эвтаназию в шестилетнем возрасте, не было ничего необычного.[291] Клоны других животных, будь то крупный рогатый скот или мыши, часто страдают от разных нарушений здоровья, например таких, как ожирение, но ни у одного из них не было описано случаев прогерии. Но все это, так сказать, дела давно минувших дней.[292] Много информации может быть получено также от людей, мутантных по теломеразе. Помимо синдрома Вернера есть еще один тип прогерии, более редкий и еще более тяжелый, при котором организм начинает катастрофически стареть еще в детстве.[293] Жертвы этого заболевания обычно умирают лет в двенадцать или около того, опять-таки от инфаркта, причем к этому моменту они по внешнему виду в точности напоминают маленьких старичков. Подобные симптомы заставляют вспомнить о дефектах теломеров. Даже если эту страшную болезнь удастся объяснить с позиций слишком быстрого клеточного старения, мы лишь на малую толику проникнем в тайны старости. Ибо прогерия, ускоряя некоторые проявления физической деградации, оставляет в неприкосновенности разум своих жертв. Жить до ста За последние десять лет в изучении стaрения произошла настоящая революция, которая по большей части связана с исследованиями червя нематоды Caenorhabditis elegans. Этот червь достигает в длину всего 1 миллиметра, так что в чашке Петри его можно выращивать тысячами. Черви эти абсолютно прозрачны, и посредством мощного микроскопа можно разглядеть каждую из 959 клеточек, которые содержатся в их живых телах. По какой-то причине в процессе экспериментов оказалось особенно легко идентифицировать мутантных червей, отличавшихся необыкновенным долгожительством. Некоторые из этих червей жили вдвое дольше обычных – сорок два дня, что на человеческий масштаб составляет сто пятьдесят лет. На сегодняшний день у червей идентифицирована по меньшей мере сотня генов, мутации которых заставляют животных жить дольше. Многие из этих мутаций выводят из строя механизмы стимуляции инсулиноподобного фактора роста (IGF), вследствие чего меняется вся физиология червя. Мутантные черви с дефектами стимулов IGF хуже размножаются, делают запасы большого количества жира и cахаров, активизируют целую батарею генов, кодирующих устойчивые к стрессу белки, в том числе и супероксиддисмутазу. В результате в чашках Петри появляются черви, излучающие здоровье, в то время как их обычные сородичи там же чахнут на глазах. Мы уже сталкивались ранее с инсулиноподобным фактором роста. Именно недостаток этого гормона делает пигмеев маленькими, а его избыток отвечает за гигантские размеры немецких догов. Он – один из тех гормонов, который при инактивации его у мышей делает их долго живущими карликами. У червей IGF, похоже, не контролирует размеры тела (что достойно удивления, поскольку у многих других созданий, включая фруктовых мушек, он выполняет именно эту функцию). Но даже при таком условии, на основании полученных на червях результатах, а также с учетом исследований IGF, проведенных на мышах, мухах и многих других существах, можно в общих чертах обрисовать механизм, вероятно, универсальный для всех животных, который позволяет им жить дольше, если в этом возникает необходимость. Черви не отличаются особым интеллектом. Нервная система любой особи, включая и ту структуру, которая у них называется мозгом, состоит всего лишь из 302 нейронов. Человеческий мозг содержит в миллионы раз больше нервных клеток. При всем при том у червя хватает ума, чтобы понять, сколько еды ему дали. Когда он чувствует, что предстоит поголодать, нейрональные сигналы от органов чувств, расположенных в его голове, передаются остальному телу, и сигнальный механизм IGF блокируется. Изменение условий жизни имитирует то, что происходит в организме многих мутантов. Результат же остается прежним: червь живет дольше.[294] Все это нам уже знакомо. Именно так обстоит дело при ограничении калорий в диете мышей и крыс. И здесь можно найти объяснение того, как и почему размеренная жизнь оказывает столь благоприятный эффект. Реакция организма на калорийное ограничение – вовсе не только странный лабораторный феномен, представляющий интерес лишь для геронтологов и специалистов по питанию, мечтающих о человеческом бессмертии. Это, вероятно, тот самый механизм, который развивался в процессе эволюции, чтобы помочь животным справиться с превратностями судьбы. Понимая, что впереди его ждут тяжелые времена, молодой организм изменял свой образ жизни. Вместо инвестирования ресурсов в ускоренный соматический рост и быстрое размножение, он переключался на программу выживания, оставаясь мелким и прекратив репродукцию, но, в сущности, делая ставку на то, что лучшие времена – раньше или позже – настанут. Если такая точка зрения на калорийное ограничение верна, тогда ее сторонники стремятся достичь не менее, чем возрождения эволюционных механизмов, позволявших нам справляться с лишениями и тяготами, которые наверняка были уделом людей на протяжении миллионов лет их предыстории (и, конечно, немалой части истории). Они не подозревают, что, высчитывая энергетическую ценность своего рациона до последней калории, окружая себя бутылочками с витаминами и ежемесячно, как положено, проверяя плотность костей, они играют роль самых ревностных противников цивилизации. Можно ли обнаружить гены долгожительства у людей? Многие ученые полагают, что да. Во Франции, Англии, Голландии, Японии, Финляндии и Соединенных Штатах геронтологи деловито составляют списки столетних жителей этих стран и анализируют их ДНК, чтобы выяснить, почему они так долго живут. Они поступают так, не рассчитывая найти одну-единственную мутацию или полиморфизм, которым обладали бы все долгожители. Более того, они полностью признают, что многие из старцев смогли дожить до такого возраста, потому что дополняли везенье достойным образом жизни. Научный подход скорее состоит в том, чтобы исследовать множество генов, которые, по той или иной причине, считаются ответственными за болезни пожилого возраста, и найти их варианты, наиболее распространенные у лиц, доживших до глубокой старости по отношению к остальной популяции. Один из первых таким образом идентифицированных генов долгожительства стал аполипопротеин E (APOE). Белок, кодируемый этим геном, существует в нескольких полиморфных вариантах, называемых ε2, ε3 и ε4. Около 11 процентов французских мужчин и женщин не старше семидесяти лет несут как минимум одну копию аллеля ε4, но у столетних французов этот показатель опускается до 5 процентов; разница восполняется за счет варианта ε2, который становится более распространенным. Это означает, что, помимо желания отпраздновать столетний день рождения, каждому из нас хорошо бы иметь по крайней мере одну копию ε2 и вовсе не иметь ε4. Так происходит из-за того, что ген APOE, который кодирует белок, включенный в перенос холестерина, играет роль в развитии болезни Альцгеймера.[295] Примерно у одного человека из десяти в возрасте шестидесяти пяти лет есть шансы стать жертвой Альцгеймера, но они неизмеримо возрастают, если человек является носителем варианта ε4. Одна копия ε4 по сравнению с ее отсутствием увеличивает риск развития болезни Альцгеймера втрое; две копии – в восемь раз. Если и этого недостаточно, тогда отметим, что ε4 также предрасполагает к сердечно-сосудистым заболеваниям. При такой удвоенной молекулярной ответственности за развитие тяжелых заболеваний нетрудно понять, почему редко кто из носителей ε4 доживает до преклонного возраста.[296] Все эти рассуждения, однако, мало что значат, если у вас темная кожа. Исследования по распространению генов АРОЕ показали, что вариант ε4 широко распространен на территории Африки к югу от Сахары. Почти у половины африканских пигмеев встречается как минимум одна его копия. Означает ли это в действительности, что у пигмеев эфе свирепствует болезнь Альцгеймера? Краткий ответ состоит в том, что мы этого не знаем. Эпидемиологические исследования относительно распространенности болезни Альцгеймера среди пигмеев никогда не проводились, и выполнить их довольно затруднительно, поскольку из-за высокой смертности от инфекционных заболеваний и несчастных случаев мало кто из пигмеев доживает до такого возраста, когда появляются признаки болезни Альцгеймера. Это само по себе может объяснить причины широкого распространения ε4 в их популяции, однако более вероятное объяснение состоит в том, что вышеупомянутый аллель менее опасен для африканцев, чем для европейцев. Почему – остается загадкой.[297] Генетика болезни Альцгеймера, по крайней мере у европейцев, является прекрасной иллюстрацией к эволюционной теории старения, пожалуй, даже еще более убедительной, чем пример с хореей Гентингтона. Даже среди явно подверженных заболеванию (белых) французов ε4 представлен в таком летальном варианте, что его распространение можно объяснить только одним: он оказывает низкий совокупный эффект на репродуктивный успех носителей. Что сильно контрастирует с другими генами, вызывающими болезнь Альцгеймера. Мутации по меньшей мере трех других генов приводят к этому заболеванию. Однако их действие проявляется уже к тридцатилетнему возрасту носителей, которые погибают в самом расцвете сил. Таким образом, гены полностью подвержены действию естественного отбора и потому редки.[298] Подобные результаты – только начало. Через несколько лет будут обнаружены десятки, если не сотни полиморфных генов, которые способны либо продлевать нам жизнь, либо укорачивать ее. Большая часть этих генов будет либо ускорять, либо задерживать развитие признаков старения, с которыми мы уже знакомы: старческое слабоумие, артериосклероз, почечную недостаточность, болезни простаты, менопаузу, рак и тому подобное. Ни один из геномов конкретного человека не будет обладать всеми генными вариантами, которые благоприятствуют долгожительству. Это ясно уже из того разнообразия путей, которыми определяется наш уход из жизни. Но, владея такими данными, можно будет описать относительный риск обладания данной совокупностью генов в статистических терминах. На основе нижеприведенных примеров можно представить, как это будет происходить. Если при прочих равных условиях геном какого-нибудь сорокалетнего человека будет характеризоваться следующими вариантами: SRY(−/−); APOE(ε2/ε2); ACE(D/D); MTHFR(Ala222/Ala222), то его обладатель меньше подвержен риску развития сердечно-сосудистых заболеваний, а следовательно, и ежегодному риску смертности, чем другой индивид со следующим сочетанием генов: SRY(+/−); APOE(ε4/ε4); ACE(I/I); MTHFR(Val222/Val222). Различия между двумя вышеприведенными записями не несут в себе никакой тайны. Имеются четыре гена SRY, APOE, АСЕ и MTHFR, каждый из которых обладает двумя вариантами, связанными, как хорошо известно, с различиями в показателях смертности у людей среднего и пожилого возраста. В таком случае эти две записи представляют собой некую прогностическую оценку старения, которую, однако, нельзя считать более обоснованной, чем утверждение, будто тот, кто не курит, не пьет, не водит машину и не занимается сексом, в целом проживет дольше того, кто это делает. Только в приведенном выше примере все факторы риска заключены в геноме. Обладание вторым вариантом генома вовсе не обязательно предрекает раннюю смерть. И хотя нельзя путем диеты избежать болезни Альцгеймера, для предотвращения инфаркта можно сделать многое. То, что гены наделяют нас различными шансами окончить свою жизнь в любом известном возрасте, кажется почти доказанным, но перевести генетические различия в разницу непрожитых лет пока невозможно. Для этого необходимы крупномасштабные популяционные исследования, которые еще не выполнены, но наверняка стоят на очереди.[299] Правда, из этого правила есть исключения. В США люди с сочетанием SRY(−/−) живут в среднем на пять лет дольше обладателей SRY(+/−), и с этим ничего нельзя поделать – разве что пожать плечами с неким галльским безразличием и пробурчать: "Vive la différence!" – "Да здравствуют различия!" Только вверх 1994 год ознаменовался исключительным событием: в тот год не умерла ни одна из восьмилетних шведских девочек. Ни одна не стала жертвой гриппа; ни одна не попала под автобус. И в начале и в конце года число их составило 112 521. Конечно, это была статистическая случайность. В том же году умерло несколько восьмилетних шведских мальчиков, так же как и семи- и девятилетних девочек, а в следующем году умерло и несколько восьмилеток обоего пола. Но то, что в означенный год выжили все эти шведские девочки, можно рассматривать как знак величайшего свершения индустриальной цивилизации – успешной защиты детей от гибели. Показатели детской смертности в экономически развитых странах становятся в наши дни бесконечно малыми, в особенности если не брать в расчет несчастные случаи или насильственную смерть. Именно это достижение, которое цивилизация стремилась воплотить на протяжении по меньшей мере последних двухсот пятидесяти лет, лежит в основе постепенного подъема к максимальным показателям продолжительности жизни человека. До 1750 года ожидаемая продолжительность жизни новорожденного составляла двадцать лет; сегодня в самых богатых странах любой только что родившийся младенец может рассчитывать дожить примерно до семидесяти пяти лет. По большей части столь разительное увеличение сроков человеческой жизни следует приписать уничтожению инфекционных заболеваний, которые поражали преимущественно юных членов общества. Удивительно, пожалуй, другое: хотя в наиболее развитых странах задачу предотвращения детской смертности можно считать решенной, ожидаемая продолжительности жизни там по-прежнему растет. Шестидесятые годы XX века были, так сказать, революционными. Но параллельно с бурей и натиском культурной и сексуальной революций происходило нечто куда более важное: в это же время начали снижаться показатели смертности пожилых людей.[300] Американская женщина, которой в 1970 году исполнилось восемьдесят лет, имела 30-процентный шанс прожить еще десять лет. В 1997 году этот же шанс для восьмидесятилетней женщины возрос до 40 процентов. Нечто подобное происходит и в Швеции. В период с 1860 по 1960 год возраст, в котором умирали самые старые шведы, постоянно увеличивался – со скоростью примерно 0,4 года за десятилетие. Между 1969 и 1999 годами этот показатель резко возрос – до 1,1 года за десятилетие. Иными словами, начиная с какого-то времени люди стали жить дольше, но после 1960-х тенденция заметно ускорилась. Такие цифры говорят нам о том, что старение можно не только вылечить, но и что существует великое множество способов лечения. Если рассматривать старение как зависящее от возраста увеличение коэффициента смертности, тогда все, что снижает этот показатель, можно, по определению, считать лекарством от старости. Уменьшение коэффициента смертности у стариков в основном связано с тенденцией нескольких последних десятилетий к снижению распространения сердечно-сосудистых заболеваний и рака. Сердечно-сосудистые заболевания были основной причиной смертности населения в Соединенных Штатах начиная с 20-х годов прошлого столетия, но между 1950 и 1996 годами их вклад в показатель смертности уменьшился почти наполовину. В Японии процент онкологических заболеваний начал снижаться уже в 1960-х годах; в остальных развитых странах подобная тенденция проявилась примерно на два десятилетия позже. В этом, конечно, нет ничего сверхъестественного, кроме стабильного прогресса в сфере общественного здравоохранения. Однако стабильный прогресс здравоохранения – это, пожалуй, все, на что мы вправе рассчитывать. Теория эволюции и постоянно растущий поток информации относительно генетики старения, то ли преждевременного, то ли, наоборот, замедленного, говорят нам, что старость есть множество болезней, которые одна за другой должны быть излечены. В то же время на пути этого прогресса нет никаких преград – ничего такого, что заставляло бы нас думать о наличии фиксированного срока человеческой жизни. В 1994 году в возрасте восьмидесяти лет умерли 1674 шведские женщины. Невозможно предсказать, какие именно открытия в области медицины смогут гарантировать такую ситуацию, чтобы в будущем все женщины этого возраста продолжали жить. Но когда такой день настанет, он будет знаменовать собой завершение второго грандиозного проекта современной индустриальной цивилизации, направленного на защиту стариков от смерти. Глава X Антропометаморфозы [эпилог] Череп австралийского аборигена, Земля Арнем. Из книги Армана де Катрфажа "Crania ethnica: черепа человеческих рас", 1882. Авторы книг по генетике, по крайней мере книг, предназначенных для широкого читателя, часто расходятся во мнениях, а если в чем-то и сходятся, так либо в предсказаниях о будущем человечества, либо в морализировании по поводу этого будущего. Иногда, правда, в их трудах можно найти и то и другое. Прогнозы неизбежно основаны на той роли, которую "новые генетические технологии" – массовые генетические обследования, селекция эмбрионов, клонирование, модификация зародышевых линий и тому подобное – будут играть в жизни индивидов и групп. Некоторые из пишущей братии полны оптимизма и уверяют нас, что все технологии ничто по сравнению с величайшими демографическими движущими силами, такими как рождаемость или миграции, которые формируют генофонд нашего вида. Другие с поразительным хладнокровием рисуют картину трансформации человеческого рода в нечто, напоминающее высокоинтеллектуальное растение. Есть такие, как правило – среди научных обозревателей в средствах массовой информации, кто хочет получить собственные клоны, другие выражают желание так реструктурировать налоговую систему, чтобы она удерживала людей с наследственными заболеваниями от воспроизводства. Кое-кто – так называемые приверженцы этического развития, биологи-диалектики и священнослужители – напыщенно говорят о "человеческом достоинстве", активно бранят "генетический детерминизм" или туманно намекают на "этические дилеммы, стоящие перед всеми", редко нисходя до объяснений, что под этим подразумевается.[301] Я предлагаю не поддаваться соблазну пойти по одному из таких путей. Я не знаю будущего, а мои взгляды на моральные проблемы клонирования людей, инженеринга зародышевых линий или любого другого технологического приема не являются ни глубоко продуманными, ни хоть в чем-то уникальными, чтобы их можно было выставить на публичное обсуждение. Эта позиция вызвана не трусостью, а, скорее, благородством – по крайней мере, так мне хочется думать. Вместо сентенций я закончу эту книгу, которая повествует о множестве вещей, известных нам относительно строения человеческого тела, некоторыми мыслями о том, чего мы не знаем и – по крайней мере я – хотели бы узнать. Я хочу больше знать об изменчивости. Эта книга посвящена преимущественно редким мутациям, наносящим ущерб организму. Если я и упоминал об изменчивости, то только мимоходом. Под изменчивостью я подразумеваю нормальные вариации человеческой внешности и признаков, которые мы видим у окружающих нас здоровых людей. Я имею в виду изменчивость, которая существует в пределах самой маленькой шотландской деревушки с ее кареглазыми, зеленоглазыми и голубоглазыми обитателями. Кроме того, я имею в виду различия по форме тела между популяциями, живущими по соседству, но чем-то друг от друга отличающимися, как, например, в случае низкорослых пигмеев и высоких банту. Я также понимаю под изменчивостью особенности цвета кожи, курчавости волос и формы глаз, которыми в большей или меньшей степени отличаются друг от друга народы, связанные своим происхождением с разными континентами. В таком случае одна из тем, о которой я хочу знать больше, связана с расой. В течение долгого времени понятие "раса" находится под прицелом критики. Среди ученых атакой руководят генетики. Их нападки основаны на двух эмпирических выводах, полученных в результате изучения характера генетической изменчивости по всему земному шару. Первым стало открытие того, что большая часть разнообразия, столь характерного для наших геномов, вовсе не делит человечество на группы, которые соответствовали бы традиционным антропологическим или общепринятым представлениям. Все гены присутствуют в различных вариантах, даже если большая часть из них "молчит" и не влияет на структуру кодируемых ими белков. Некоторые варианты с неизбежностью чаще представлены в одних частях света по сравнению с другими. Но широта распространения или, наоборот, редкость отдельных генных вариантов в разных областях земного шара не совпадает с традиционными границами расовых ареалов. Обычно считается, что границы между расами должны быть резкими, а изменения частот генных вариантов, как правило, сглажены. Изменения частот разных генов могут также не согласовываться между собой. Если разделить человечество на некие сегменты, большая часть генов попросту не обнаружит, к какому именно отсеку относится. Другое открытие, которое заставило – и заставляет – генетиков сомневаться в существовании рас, – это широкое распространение генетического разнообразия даже в пределах самых маленьких популяций. Около 85 процентов всего спектра генетической изменчивости можно обнаружить внутри любой страны или популяции – к примеру камбоджийцев или нигерийцев. Еще около 8 процентов отличают друг от друга народы – скажем, голландцев от испанцев. Таким образом, остаются какие-то жалкие 7 процентов или около того на все разнообразие различий между континентами или, при наиболее либеральной интерпретации термина, "расами". Конечно, между голландцем и представителем племени динка существуют генетические различия, но они не больше тех, которые свойственны двум любым уроженцам города Делфт. Эти факты относительно генетической изменчивости человека были известны давно, еще в 1960-х годах. С тех пор каждое десятилетие тому находились новые подтверждения, снабженные еще более внушительным количеством данных, полученных с использованием все более продвинутых способов обнаружения и анализа генетического разнообразия. В 1960-х генетическую изменчивость изучали с помощью миграции различных белков на геле; сегодня методом изучения служит секвенирование целых геномов. Поколения ученых интерпретировали результаты своих исследований приблизительно так, как сделал это здесь я, уверенно утверждая, что расы, по крайней мере в генетическом смысле, не существуют. Они представляют собой искусственные образования, социальные понятия или же остатки дискредитированных идеологических систем.[302] Однако большинству людей такие доводы казались неубедительными. Они восприняли главную мысль: расы сегодня – почему-то не совсем то, чем они были раньше. И лучше вообще избегать этого слова, заменяя его термином "этническая принадлежность" или чем-то подобным, что дает возможность удачно соединить культурные и физические варианты. Для некоторых настаивание на существовании рас есть проявление стойких расистских взглядов. Я полагаю, что они не правы. По-моему, уроки генетиков столь широко игнорируются именно потому, что они явно противоречат фактам, которые находятся у нас перед глазами. Если расы не существуют, тогда почему же при мгновенном взгляде на лицо незнакомца мы можем распознать континент, а иногда и страну, в которой жили он или его предки? Ответ на этот вопрос следует искать в тех самых у процентах, сколь жалкими они бы нам ни казались, которыми отличаются люди в разных частях света. Семь процентов – действительно малая часть от общего генетического разнообразия, однако она достаточно велика, чтобы заключать в себе наличие сотен, а может быть, и тысяч полиморфных генов, которые являются обычными и широко распространенными на одном континенте и редкими или даже отсутствующими на другом. В последние годы некоторые генетики занялись поиском таких вариантов. Они известны под названием "Информативных маркеров происхождения" ("Ancestry Informative Markers" – AIMs), названных так потому, что могут действительно приблизительно сообщить, откуда происходят ваши предки, или даже разобраться с ними, если они – как это часто бывает – происходят из разных мест. Поиски AIMs, которые поначалу фокусировались на африканских и европейских популяциях, но теперь постепенно охватывают и другие группы, ведутся в надежде найти генетические основы некоторых заболеваний, например диабета 2-го типа, риск развития которого различается у африканцев и европейцев.[303] Многие AIMs yже обнаружены. Для некоторых из них причины их присутствия на одном континенте и отсутствия на другом вполне очевидны. Один из вариантов гена FY (Duffy) широко встречается у африканцев, но крайне редок среди других народов. Африканский вариант выглядит странным, поскольку он препятствует продукции белка, кодируемого геном FY. Все остальные варианты способствуют образованию белка, хотя его форма также может варьировать. Белок FY – это рецептор фактора роста на клетках крови, которым как будто пользуются также и малярийные паразиты, поэтому его отсутствие у африканцев можно почти наверняка считать результатом длительного действия естественного отбора для защиты от болезни. Факт отсутствия FY у африканцев и его наличия в других частях света был известен на протяжении нескольких последних десятилетий.[304] В наши дни обнаружены многие другие отличия, хотя обыкновенно и не столь разительные, как в случае с FY. Никто не знает, каковы функции большинства AIMs и почему они встречаются в том, а не другом месте. Тем не менее где-то среди всех этих AIMs находятся гены, благодаря которым китайский ребенок народности хань будет иметь характерную складку верхнего века, а житель Соломоновых островов – темный, граничащий с лиловым, цвет кожи. Среди них будут находиться также гены, определяющие форму нашего черепа. Измерение черепов имеет давнюю традицию в антропологии. Одним из первых по-настоящему грамотных измерителей был голландец Петрус Кампер, который в XVIII веке изобрел "лицевой угол", по сути – показатель лицевой уплощенности. На своей знаменитой схеме Кампер изобразил серии голов и черепов, куда входили низшая обезьяна, орангутан, африканец, европеец, греческая статуя, с постепенно уменьшающимся лицевым углом. Сам Кампер не был расистом. В своих трудах он неоднократно подчеркивал тесное родство между всеми людьми независимо от их происхождения. "Протяните вместе со мной, – призывал он в 1764 году, – братскую руку неграм и признайте в них истинных потомков первого человека, на которого все мы должны смотреть как на нашего общего прародителя". К этому он добавлял, что первый человек мог быть белым, коричневым или черным и что европейцы – просто "белые мавры", причем все это он писал в то время, когда Линней делил человечество на расы. Вариации человеческих черепов. Из книги Армана де Катрфажа "Crania ethnica: черепа человеческих рас", 1882. К сожалению, рисунки Кампера убеждали больше его же собственных слов, а схема, скрыто демонстрирующая восхождение от обезьяны к Аполлону (где африканцы располагались намного ближе к обезьянам, чем к божествам), стала краеугольным камнем антропологии XIX века. Нет нужды повторять или критиковать результаты краниометрических исследований, выполненных в XIX – начале XX века, которые ставили целью показать, что одно из подразделений человечества обладало большим или меньшим интеллектом по сравнению с другим. Многие авторы уже писали об этом с таким тщанием, которого едва ли заслуживают научные достоинства подобных исследований.[305] Стоит отметить, однако, что современные специалисты в области физической антропологии продолжают испытывать интерес к описанию формы черепа, хотя сегодня они используют для этого трехмерные лазерные сканнеры и многомерную статистику. Они приходят к выводу, возможно не вызывающему удивления, что при всем внутрипопуляционном разнообразии люди из разных частей света характеризуются различной формой головы. В согласии с утверждениями Кампера, у людей из африканской суб-Сахары челюсти действительно в среднем выступают вперед больше по отношению к вертикали лба, чем у европейцев. Этот признак известен под названием "прогнатизм". Меланезийцы и австралийские аборигены также более прогнатны, чем европейцы. Противоречит выводам Кампера, однако, то, что эта характеристика не делает африканские (или аборигенные) черепа ближе к обезьяньим, чем к европейским, черепам. Лицевой угол – это довольно-таки грубый способ описания чрезвычайно сложных особенностей формы черепа. Он не делает различий между разными аспектами прогнатизма. У шимпанзе высокие значения лицевого угла обусловлены наклоном всей лицевой части и лба; у африканцев и австралийских аборигенов более высокие значения угла по сравнению с европейцами вызваны исключительно выступанием челюстей. Кроме того, европейцев вовсе нельзя считать самыми плосколицыми. Этой привилегией, если она таковой является, обладают инуиты Северной Канады. Человеческие черепа изумительно разнообразны. Инуиты также отличаются очень крупными глазницами и массивными скуловыми костями. По сравнению со всеми остальными людьми народы койсанской группы в Южной Африке обладают выступающими лобными костями (нависание лба); у аборигенов Австралии – массивные брови (надбровные дуги); у некоторых обитателей африканской суб-Сахары широко расставлены глаза (большое межорбитальное расстояние); у жителей Андаманских островов (негритосов) – небольшие круглые черепа. Список различий можно продолжать до бесконечности. Немногие из этих различий являются абсолютными. Подобно тому как большая часть разнообразия генных частот обнаружена внутри, а не между популяциями (народами, континентами), изменчивость формы черепа в основном характеризуется теми же закономерностями. А все различия между популяциями очень незначительны. Австралийские аборигены и инуиты отличаются по показателю выступания челюстей (прогнатизму) всего лишь на 6 процентов. Да, различия невелики, но, принимая во внимание то значение, которое мы придаем лицам друг друга, они сразу же бросаются в глаза.[306] Мое убеждение в том, что вскоре мы сможем идентифицировать гены, ответственные за вариации формы черепа, заключает в себе важный вопрос: а есть ли вообще такие гены? В 1912 году американский антрополог Франц Боас решил продемонстрировать, что их нет. Он был человеком, стоявшим на позициях гуманизма и толерантности, непримиримым оппонентом тех, кто пытался провести обидные границы между людьми на основе формы их черепа. Приведенная ниже цитата из одной серьезной антропологической статьи, написанной в 1905 году немецким зубным врачом по фамилии Рёзе, поможет понять, против чего боролся Боас: "Длинные головы людей германского происхождения характеризуют носителей более высокой духовной жизни, обладателей верховных позиций, которые предназначены им природой, истинных защитников отечества и социального порядка. Все их свойства предопределяют их аристократическую сущность".[307] И так далее, вплоть до осуждения более демократически мыслящих и негерманских "круглоголовых". "Длинные" и "круглые" головы определяются значениями "головного указателя", представляющего собой отношение ширины черепа к его длине, выраженное в процентах. У длинноголовых, или долихоцефалов, головной указатель ниже 75; у круглоголовых, или брахицефалов, – выше 80; мезоцефалы характеризуются промежуточными цифрами. Заметив, что эмигранты, прибывающие на остров Эллиса, – богемские чехи, словаки, венгры, итальянцы, шотландцы и восточноевропейские евреи – несколько отличаются по своему головному указателю, Боас задался вопросом, являются ли эти различия генетическими (согласно его терминологии – "расовыми") или же обусловлены влиянием среды. Он вполне обоснованно рассуждал, что если головы детей, родившихся в Америке у представителей всех этих групп, будут больше похожи друг на друга, чем на головы тех, кто родился в Европе, значит, условия среды, а не происхождение являются причиной различий. Боас измерил около 13 тысяч голов – грандиозный проект, который, в отсутствие компьютера, погрузил его в нескончаемый поток цифр.[308] Тем не менее он сумел вычертить график, который как будто показывал, что значения головного указателя у родившихся в Америке детей сицилийцев и восточноевропейских евреев и вправду сближаются друг с другом (отметим, что обе группы изначально были скорее долихоцефальными). Это был разительный пример появления новых голов в Новом Свете. Исследование Боаса нанесло краниометрии почти смертельный удар. За последние девяносто лет его цитировали несчетное число раз – не в последнюю очередь покойный Стивен Джей Гульд – в качестве доказательства "пластичности" формы черепа, а следовательно, ее обусловленности негенетическими различиями.[309] Боас, однако, оказался неправ. Его данные были недавно заново проанализированы с использованием современных статистических методов. Черепа детей, родившихся в Америке, на самом деле отличаются от черепов их родителей, но отличия эти противоречивы и не носят характер закономерности. Действительно, выбери Боас для сравнения детей шотландских или венгерских эмигрантов вместо сицилийцев и восточноевропейских евреев, он смог бы показать, что под влиянием американских условий черепа по форме удаляются друг от друга, а не сближаются. Но ошибка Боаса коренилась в чем-то более глубоком. Повторный анализ его данных показал также, что изменения формы черепа у детей, родившихся в Америке, вне зависимости от направленности этих изменений, были ничтожно малы по сравнению с теми различиями, которые сохранялись и были обусловлены их предками, семейной принадлежностью, или – для лаконичности – генами.[310] Действительно, если оставить в стороне европейских мигрантов, это едва ли покажется странным. Эксперты в области судебно-медицинской антропологии в Соединенных Штатах и Англии вполне в состоянии распознать, принадлежит ли данный череп, возможно свидетельствующий о каком-то преступлении, человеку африканского или европейского происхождения. То, что они могут это сделать после десятилетий или даже столетий сосуществования народов, не говоря уж о наличии значительной доли примеси, означает, что наши различия сохраняются, как часто говорят, не только на уровне кожи, но и на уровне черепа, а возможно, и того, что в нем содержится. Итак, генетические различия существуют между самыми разными людьми. Должны ли мы попытаться выяснить их природу? Многие ученые полагают, что нет. Некоторые считают достаточным просто заявить, что физическое разнообразие, существующее между человеческими популяциями, их "не интересует" и недостойно изучения. Другие признают, что такие исследования интересны, но проводить их не рекомендуется, поскольку даже размышления на эту тему могут породить вспышки социальной несправедливости. Они страшатся возрождения не расовой, а расистской науки. Со своей стороны я был бы счастлив узнать о генах, отвечающих за разнообразие человечества и определяющих различия между людьми – будь то мужчины и женщины, живущие в одной и той же деревне, или индивиды, никогда не покидавшие своих родных континентов. В некоторой степени мною движет простая любовь к познанию. Это чувство возникает тогда, когда я смотрю на картину Данте Габриеля Россетти "Ла Гирландата", понимая, что у его модели Алексы Уайлдинг было две мутации утраты функций гена MC1R, которые и сделали ее обладательницей роскошных рыжих волос. Радость познания отчасти всегда сопровождает любые занятия наукой, но к этому следует прибавить некое особое удовольствие, которое возникает тогда, когда удается понять причину явления ранее знакомого, хотя и абсолютно загадочного. Точка зрения, что человеческая изменчивость не представляет интереса для науки, кажется мне излишне высокомерной. В конце концов, игнорируя человеческое разнообразие, популяционные генетики десятилетиями усиленно растрачивают свою энергию (запасы которой кажутся неисчерпаемыми) на изучение разновидностей окраски раковин у садовых улиток или числа щетинок на спинках плодовых мушек – задач, которые в интеллектуальном отношении весьма близки к тем, которые демонстрируются изменчивостью человека. Утверждение, что генетика человека морально опасна, выглядит более серьезным. Зная историю науки о расах, конечно, можно понять причины возникновения такого мнения. Тем не менее оно совершенно неуместно. Разумные люди знают: различия между представителями человеческого рода настолько невелики, что с их помощью нельзя причинить сколько-нибудь значимый ущерб идее социальной справедливости. "Человеческое равенство, – если позаимствовать крылатое выражение Стивена Джея Гульда, – есть условный факт человеческой истории". Справедливо, однако, другое: пока причины человеческой изменчивости остаются неизвестными – пока те самые 7 процентов генетического разнообразия, различающие людей из разных частей света, пребывают в забвении, всегда найдутся те, кто использует это незнание для пропаганды теорий с социально опасными последствиями. Несправедливость иногда может возникать из-за нового знания, но чаще, гораздо чаще, она просачивается сквозь щели нашего невежества. Возможно, самый неотразимый довод в пользу того, что мы должны вновь обратить все наше внимание на изучение физического разнообразия человечества, заключен в угрозе его исчезновения. В Юго-Восточной Азии численность негритосов, этих загадочных, похожих на пигмеев людей, постоянно снижается. Они ведут образ жизни охотников-собирателей. В эпоху неолита они были вытеснены земледельцами и скотоводами, говорящими на австронезийских языках, и сохранились в основном на отдаленных островах. Теперь им угрожает современная цивилизация. На Малых Андаманских островах немногие сохранившиеся онге живут в резервациях. На Больших Андаманских островах несколько сот ярава выжили только потому, что защищались от любопытствующих луком и стрелами (за последние пятьдесят лет они убили или ранили более сотни человек). Теперь они выходят из лесных убежищ, привлеченные безделушками, которые предлагают им индийские власти. Есть опасность, что вскоре они станут жертвами туберкулеза, кори и культурного шока, как это случилось ранее с их предшественниками. Таковы лишь недавние примеры печальных последствий австронезийской и европейской экспансий (не говоря о китайцах, банту или хараппах). В 1520 году Фернан Магеллан, приблизившись к проливу, который сегодня носит его имя, сообщил о существовании расы гигантов, которые живут в глубинах Огненной Земли. Он назвал их патагонцами, по имени гиганта из испанского рыцарского романа. В дальнейшем путешественники разукрасили его рассказ новыми подробностями. К 1767 году эти гиганты, дикие и безжалостные, увеличились в размерах до 3 метров. Сегодня гиганты Огненной Земли полностью забыты и представляются фантастическими существами, наподобие плиниевских аримаспов. И все же патагонцы реально существовали. Они именовали себя "селкнам" или "она", средняя длина тела взрослого мужчины в их группе равнялась 178 сантиметрам и была гигантской только на взгляд испанских моряков XVI столетия. Но если их рост не представляется особенно примечательным, то черепа, несомненно, обладают исключительными свойствами. Они крепкие, толстые и очень массивные, что отличает их от всех других человеческих черепов. Те же особенности были характерны и для остального скелета. Существует несколько фотографий селкнамов. На них изображены красивые и физически крепкие люди, одетые в накидки из шкур гуанако, на которых они охотились пешими, с луками величиной в человеческий рост. Владельцы аргентинских скотоводческих ранчо перебили всех селкнамов в результате массового геноцида; последний из патагонцев умер где-то в 1920-х годах.[311] Группа селкнамов, Огненная Земля, ок. 1914 г. (Королевское географическое общество, Лондон) Есть еще кое-что, о чем мне хотелось бы знать. Это феномен куда более общий, чем раса, и почти столь же противоречивый. Имя ему – красота. Красота есть то, что мы видим (или слышим, ощущаем на ощупь или по запаху) и что доставляет нам наслаждение. Как таковая она обладает, или, по крайней мере, кажется, что обладает, бесконечным разнообразием форм. В данном контексте меня интересует только физическая красота. "Красота, – пишет философ Элейн Скерри, – ускоряет рождение детей: когда глаз видит нечто прекрасное, тело жаждет воспроизвести образец". Платон, подчеркивает она, высказывал ту же идею. В "Пире" Сократ рассказывает, как мантинеянка Диотима учила его искусству любви и как они рассуждали о природе любви и красоты. "Я объясню проще, – говорит Диотима. – Любовь вовсе не есть стремление к прекрасному, как то тебе, Сократ, кажется". – "Тогда что же она такое?" – "Стремление родить и произвести на свет в прекрасном". – "В самом деле?" – "Уверяю тебя, что это так". Сам Дарвин не смог бы выразиться лучше. Большая часть его книги "Происхождение человека и половой отбор" посвящена изучению существования красоты, ее восприятия и назначения. "Самая утонченная красота, – пишет он, – служит всего лишь для привлечения внимания самки и ни для каких иных целей". Он размышлял о хвостовых перьях самцов аргусового фазана с геометрически расположенными на них пятнами. Но психология фазанов и жителей островов Фиджи, по его мнению, не слишком отличается. Для Дарвина любовь к красоте – одна из главных эволюционных сил, уступающая по значению только естественному отбору. Существа, поколение за поколением выбирающие красоту, привнесли в мир живой природы большую часть ее роскоши. Половой отбор снабдил мадагаскарского хамелеона рогами; рыбу меченосца – знаменитым мечом; райских птиц и павлиньих фазанов – хвостами. Он сформировал разнообразие человеческого вида. Одна из поразительных вещей в дарвиновском описании красоты состоит в том, что, не ссылаясь на философов и художников, он сформулировал свой взгляд на основные принципы эстетики. Он хочет знать, является ли красота общим или частным понятием, часто или редко она встречается, есть ли в ней смысл. На все эти вопросы Дарвин дает абсолютно четкие ответы. Физическая красота, утверждает он, не универсальна, а скорее специфична. Разные народы в разных частях света имеют собственные представления о красоте. А еще она редка. Быть красивым значит быть в чем-то отличным от окружающих. Кроме того, она бессмысленна. Наш мозг, по тем или иным причинам, воспринимает некоторые вещи как красивые независимо от других качеств, которые могут быть им свойственны. Красота ничего не значит. Она существует сама по себе. Все суждения Дарвина о красоте отличались, как это вообще было ему свойственно, непринужденной оригинальностью. В "Происхождении человека", например, не содержится никаких намеков на классический идеал красоты – тот самый, который начиная от архаических куросов и до речей Антиноя в течение нескольких столетий воспроизводился по всему Средиземноморью, как будто бы в основе всех этих представлений лежала определенная формула. И такая формула действительно существовала. В эпоху Возрождения это привело к созданию теории о том, что в основе красоты человеческого тела лежит божественная пропорция. В XVIII веке эта теория превратилась в стандарт, с помощью которого надлежало оценивать все человечество. Именно этот идеал заставлял Винкельмана утверждать, что древние греки были самыми прекрасными из всех людей (хотя современных неаполитанцев он также считал весьма привлекательными); Кампера – расположить голову греческой статуи в самом конце варьирующего ряда лицевых углов; Бюффона – поместить "зону красоты" между 20 и 35° северной широты и включить в нее все народы, живущие от Ганга до Марокко: персов, турок, черкесов, греков и европейцев. Этот же идеал побудил Бугенвиля по приезде на остров Таити в 1768 году восхвалять его жителей словами классической идиллии в стиле пасторалей Ватто. Дарвину удалось избежать всего этого. Он не говорит нам, что сам думает о красоте, а пытается узнать, что думают о ней другие люди. Он коллекционирует рассказы путешественников. Американские индейцы, как ему сообщали, считают, что женская красота включает в себя широкое плоское лицо, небольшие глаза, выступающие скулы, низкий лоб, широкий подбородок, крючковатый нос и свисающие до пояса груди. Маньчжуры отдают предпочтение женщинам с огромными ушами. В Кохинхине[312] у красоток круглые головы; в Сиаме – ноздри развернуты в разные стороны; готтентоты любят женщин с такой крайней формой стеатопигии, что они, если сядут, сами не смогут подняться. Дарвин сомневался в качестве таких данных и был в этом абсолютно прав. Но в целом он вполне убежден в том, что разные народы воспринимают красоту по-разному. Его точка зрения весьма притягательна. "Per motto variare la nature e bella" – "Красота природы лежит в ее большом разнообразии" – это мог бы сказать Дарвин или Бенеттон, хотя в действительности крылатая фраза принадлежит Елизавете I. В самом деле, стоит взглянуть на бурлящий мир моды – и ни у кого не останется сомнения, что любовь к красоте зачастую принимает особую форму любви к редким и бесполезным вещам. Среди специалистов, занимающихся изучением красоты, – а научный подход к красоте становится все более модным, – взгляды Дарвина часто воспринимаются как довольно странные. В наши дни большинство исследований на эту тему начинается с того, что стандарты красоты универсальны, что присутствие красоты весьма распространено и что красота вовсе не бессмысленна, а, напротив, способна о многом поведать. Универсальность стандартов красоты настолько же очевидна, как и их специфичность. Видимое противоречие легко устранимо, если только признать, что есть такие особенности, в отношении которых вкусы расходятся, и другие, которые всем нравятся. Рост волос (на голове, лице или теле), пигментация (глаз, волос и кожи), возможно, также форма тела (соотношение обхвата бедер и талии) по-разному воспринимаются отдельными людьми, в разных регионах и в разные эпохи. Но в случае относительной моложавости, по крайней мере при оценке женщин мужчинами, вкусы сходятся. Так же, как, по-видимому, и относительно определенного типа лиц. Усредненные лица, как кажется, повсеместно считаются более привлекательными, чем большинство, но не все, резко отличных от них вариантов. Симметрия оказывается предпочтительней асимметрии. Существует обширная литература, посвященная поискам того, кто что считает красивым и когда. Результаты этих исследований в большинстве своем очевидны. В конце концов, если коренного жителя Папуа – Новой Гвинеи привести в Лондонскую национальную галерею и предложить ему на выбор в качестве партнерши Венеру Боттичелли (с картины "Марс и Венера") или "Гротескную старуху" с картины Массейса, он, вероятно, останется индифферентным к обеим, но можно не сомневаться, какую из них предпочтет. Смысл красоты более противоречив. Здесь я хочу подчеркнуть всего лишь одну мысль: красота говорит нам о физиологическом состоянии организма и является, по сути, сертификатом здоровья. В самой простой форме справедливость этого утверждения вполне очевидна. Чистая кожа, ясные глаза, белые зубы – это одновременно проявления красоты и здоровья. Не случайно бразильские мужчины, приметив красивую кариоку[313], восхищенно вздохнут: "Que saude!" – "Какое здоровье!" Менее очевидно, однако, другое: связаны ли со здоровьем определенные пропорции лица и их симметричность. Исследования с использованием полученных на компьютере изображений свидетельствуют: мы воспринимаем красивые лица как здоровые. Но попытки установить связь между красотой и здоровьем конкретных людей дают низкие и неустойчивые коэффициенты корреляции. Возможно, так происходит оттого, что красота больше не является тем, чем была. На протяжении всей человеческой истории плохое здоровье было по большей части вызвано питанием и патогенными организмами, а именно недостатком первого и избытком вторых. Красота могла служить индикатором либо благоприятных условий среды, либо способности противостоять различным напастям. Доказать, что это в значительной степени правда, помогли бы данные о снижении изменчивости красоты хотя бы в развитых странах при увеличении ее средних значений. Зоб и кретинизм все еще поражают людей на обширных территориях земного шара, но они больше не встречаются у швейцарцев. Безобразные следы оспы исчезли повсюду. Даже в Англии зубы у большинства людей сохраняются теперь вплоть до кончины. Интересно было бы узнать, как болезни, поражающие множество детей на планете, – такие как филяриоз, малярия, сонная болезнь, – не говоря уж о различных формах дефицита питания, отражаются на симметрии и пропорциях лиц взрослых людей, сумевших пережить все эти невзгоды и недуги. Несомненно, что благосостояние также дорого обходится красоте – она платит за него ожирением, больными зубами и стрессом. Но при благоприятном соотношении тех и других воздействий – а так оно и должно быть – в любой аудитории американского или европейского колледжа содержится такой избыток красоты, которого в человеческой истории прежде никогда не существовало. Это может показаться невероятным, но лишь потому, что мы мало знаем об успехах красоты. Красота подобна богатству. Со временем она увеличивается, но распределение ее остается неравномерным. Сколько бы у нас ее ни было, всегда кажется, что у кого-то ее еще больше. Отчасти это происходит из-за того, что красота как признак здоровья есть также признак богатства. Допустим, однако, что существует общество, богатое и эгалитаристское, все члены которого обладают одинаковым здоровьем. Примерно к такому общественному устройству приближаются Нидерланды (а Великобритании и Соединенным Штатам до него еще ох как далеко). В таком обществе по одному внешнему виду ребенка нельзя будет судить о его социально-экономическом положении. Но будут ли при этом все одинаково красивы? Исчезнут ли различия в физической красоте? Думаю, что нет. Каким бы красивым ни казался себе средний голландец, некоторые из соотечественников все же будут красивее его. Я подозреваю, что красота содержит некую остаточную дисперсию, которая не исчезнет даже после выравнивания условий воспитания. Остаток этот определяется нашими генами.[314] Последствия плохого питания в детстве и воздействия патогенов могут и не отразиться на лицах, но груз мутаций на них наверняка будет заметен. Когда медицинские генетики пытаются диагностировать симптомы заболевания, имеющиеся у их пациентов, они первым делом смотрят на лица. Они знатоки в распознавании таких тонкостей, которые часто служат единственным внешним проявлением более глубоких нарушений генетического порядка: плоский фильтр, низко посаженные уши, задранный кверху нос, узко или широко расставленные глаза. Многие, если не большинство, из тех расстройств, которые обсуждались в этой книге, – от ахондроплазии до пикнодизостоза – можно отследить по лицам пациентов.[315] Получается, что наши лица очень подвержены мутациям. Или, может быть, мы просто очень хорошо умеем различать на них эффекты мутаций. Так или иначе, похоже, что последствия мутаций запечатлены на всех наших лицах, а не только у тех, кто страдает определенными клиническими заболеваниями. В начале этой книги я писал, что каждый только что зачатый зародыш уже имеет, по прикидкам специалистов, в среднем около 300 мутаций, которые создают угрозу его здоровью. Кажется просто невероятным, что мы как биологический вид настолько неуспешны. Однако некоторое количество мутаций элиминируется отбором еще на стадии внутриутробной жизни. Пятнадцати процентам женщин, которые знают о своей беременности, угрожает выкидыш. Те, кто еще даже не подозревает о зачатии, теряют гораздо больше эмбрионов. Более 70 процентов самопроизвольно абортированных зародышей отличаются тяжелыми хромосомными аномалиями; весьма вероятно также, что многие из них характеризуются мутациями определенных генов. Сейчас мало кто сомневается, что выкидыши – тот эволюционный механизм, который позволяет материнскому организму отслеживать и освобождаться от генетически неполноценного потомства.[316] Мутации – это игра случая, в которую играем все мы – и все проигрываем. Причем некоторые из нас проигрывают больше, чем другие. Простые вычисления помогут нам представить, как выглядит распределение этих проигрышей. Если предположить, что из 300 мутаций, в среднем отягощающих любой только что зачатый зародыш, 5 элиминируются из популяции в каждом поколении за счет гибели (выкидыши, младенческая и детская смертность), тогда в среднем на взрослого человека приходится 295 вредных мутаций. Наименее отягощенные ими люди, составляющие в популяции один процент, будут иметь около 250 мутаций, а наиболее отягощенная часть – 342 мутации. Где-нибудь в мире живет человек с наименьшим количеством мутаций, что составляет примерно 191.[317] Эти расчеты подтверждают интуитивное представление о том, что ни один из нас не выходит из генетического казино без потерь. Но все это не более чем предположения, хотя и основанные на научных фактах. Они также не принимают во внимание относительную цену каждой мутации. Они эквивалентны подсчету проигрыша по числу фишек, которые возвращены в игорный дом, без учета их стоимости. Вероятнее всего, цена большинства мутаций невелика. Они доставляют нам мелкие неприятности наподобие болей в спине и плохого зрения. Я подозреваю, что они также снабжают нас неровными зубами, бесформенным носом и асимметрично расположенными ушами. Если это так, тогда истинный смысл красоты заключается в относительном отсутствии генетических ошибок. Признаюсь, что у этой идеи мало доказательств, особенно когда речь идет о людях. Эволюционные биологи давно высказывают предположения, что павлиний хвост и рев благородного оленя служат сигналами генетической добротности. Они собрали много данных в поддержку этой теории, в большинстве своем малодоказательных. Объяснение красоты в контексте мутационной нагрузки совпадает, однако, с нашими интуитивными представлениями или предрассудками относительно распределения красоты. Если вредоносные мутации лишают нас красоты, тогда они должны действовать особенно эффективно в случае браков, заключаемых между родственниками. Большая часть новых мутаций, по крайней мере в какой-то степени, рецессивны, и инбридинг должен усиливать их отрицательное воздействие, поскольку они переходят в гомозиготное состояние. За близкородственные браки, несомненно, приходится платить дорогую цену: у детей кузин и кузенов врожденные дефекты встречаются на 2-4 процента чаще, чем у потомков неродственных индивидов. Хорошо бы выяснить, будут ли дети близких родственников считаться менее красивыми по сравнению с их сверстниками, родившимися у не состоящих в родстве индивидов. Подходящим местом для таких исследований мог бы стать Пакистан, где до 60 процентов браков заключается между двоюродными братьями и сестрами. С другой стороны, люди смешанного происхождения, такие, например, как бразильцы, должны демонстрировать эстетические преимущества подавления своих рецессивных мутаций: "Que saude!" – "Какое здоровье!" Что же делает физическую красоту столь замечательной? Что позволяет ей захватывать нас врасплох, не дает равнодушно относиться к ней, невзирая на всю нашу пресыщенность рекламными и гламурными образами, которые экспроприируют красоту и заставляют нас усомниться в ее силе? Если ответ, который я пытался вкратце обрисовать здесь, содержит некую толику правды, тогда каждый образ прекрасного лица или совершенной по форме ножки воплощает собой не просто то, чем он на самом деле является, а скорее то, чем он не является. Он сигнализирует об отсутствующих несовершенствах: о тех механических ошибках, которые подстерегают нас в материнской утробе, в детстве, в зрелости и старости и которые столь широко распространены, что стоит нам увидеть кого-то, кто как будто бы избежал их, хотя бы только внешне, как мы замираем в изумлении и восторге. Красота, говорит Стендаль, есть лишь обещание счастья. Возможно. Но она есть также и память о несчастьях. Благодарности Работая над этой книгой,я задолжал многим людям. Мой агент Катинка Мэтсон из Brockman Inc. впервые поняла, чем могут стать "Мутанты". Я благодарен ей, так же как и Карен Мерфи из издательства Viking Penguin USA, Мартену Карбо из Contact, Нидерланды, и более всего – Майклу Фишвику из HarperCollins UK, чья вера в окончательное воплощение книги была непоколебима, хотя и подвергалась испытаниям. Роберт Лейси, также из HarperCollins, был замечательным редактором, мой голландский переводчик Роберт Верной – проницательным критиком. Некоторые друзья и коллеги сделали свои замечания по поводу тех или иных частей книги, среди них: Остин Берт, Арнольд Хемакерс, Барбара ван Эейзерен, Мари-Франс Леруа, Ян-Рулов Остра, Корин Перне и Джонатан Свайр. Оливия Юдсен, Клер Исак, Дженнифер Рон и Альберто Саес также прочли книгу и сделали ряд полезных замечаний. Я перед ними в неоплатном долгу. Многие из моих друзей и коллег отвечали на мои конкретные вопросы. Среди них: Элизабет Аллен, Алан Эшворт, Питер Бейтон, Цзинь Цзян, Франсуа Деланж, Франк Дикоттер, Сол Дубои, Адемар Фрер-Масиас, Фритон Галис, Джил Хелмс, Кристиан Хертель, Аннемари Хеумакерс, Майкл Хохберг, Беатрис Хауэрд, Грейс Иоанниду, Мартин Кемп, Ханнелора Кишкевиц, Дебора Позел, Лизбет Раузинг, Раймунд Рос и Джон Уилмот. Ян-Рулоф Остра в Амстердаме, Седрик Кремьер и Жан-Луи Фишер в Париже с особой щедростью делились со мной своими знаниями по тератологии и ее истории. Вероник Дассен из Фрибурга рассказала мне о тератологии в Древнем мире; Марта Лар и Роберт Фоли из Кембриджа показали мне замечательную коллекцию черепов; Иегуда Корен и Элиат Негев из Иерусалима рассказали мне о судьбе семьи Овиц в Третьем рейхе. Я не знаю, как отблагодарить их за полученные от них знания. Мои ученицы Энн Ригби и Сара Ахмед рассказали мне о таких вещах, которые просто необходимо было включить в книгу; Кэролайн Ричардсон и Айрин Майер разыскивали и переводили тексты. Я не смог бы дать иллюстрации к книге, если бы не помощь Мириам Гутьерес-Перес из Wellcome Library for the History of Medicine, Лондон, а также Лоры Линдгрен и Гретхен Ворден из музея Мюттера в Филадельфии. Но в самом неоплатном долгу я перед теми, кто меня окружает: перед моими коллегами по Imperial College, перед коллегами по лаборатории, которых я, к сожалению, не назвал; перед моими друзьями Остином Бертом, Джимом Исаком, Оливией Юдсон, Гиоргосом Кокорисом, Вассо Купофану, Михаэлисом и Катериной Кутруманидис, Александрой Мелиаду, Дженни Рон, Джонатаном Свайром, Лисбет Веррейдт; перед членами моей семьи – Мари-Франс, Гарри, Ирацемой, Джозефом, в особенности перед родителями – Антуаном и Иоханной. Но превыше всего я благодарен Клер Исак, которая поддерживала меня на протяжении всего периода написания этой книги. Ей я с любовью посвящаю свой труд. P.S. Размышления, интервью, рекомендации... [об авторе] Собиратель ракушек С Арманом Мари Леруа беседует Луиз Такер Где вы росли? Я родился в Веллингтоне, Новая Зеландия, в 1964 году и прожил там до пятилетнего возраста, а потом переехал в Преторию, Южная Африка, где жил до четырнадцати лет, а потом переехал в Ванкувер, Канада, где жил до... сейчас уже точно не помню!.. До двадцати одного года. Что заставляло вас так много путешествовать? Чем занимались ваши родители? Мой отец был голландским дипломатом. На самом деле я голландский подданный, и у меня голландский паспорт. Но я никогда не жил в Голландии. А вам бы этого хотелось? Да! Когда я заработаю много денег, я куплю один из таких высоких и узеньких домиков XVII века, окаймляющих амстердамские каналы. Думаю, что Хейренграхт[318] подойдет. Какую из этих стран вы любите больше? Я очень полюбил Южную Африку; уехать оттуда было настоящей мукой. Но теперь я так же привязался к Англии. Каковы ваши воспоминания о первых научных впечатлениях? Это началось в школе? Я был, можно сказать, юным натуралистом. Все началось лет в одиннадцать или около того. Ну, знаете, наблюдал за птицами, собирал камни, ракушки и всякую всячину. В нашей семье все были коллекционерами: прирожденными, патологическими собирателями. Мои родители всюду возили за собой здоровенный мешок с ракушками с новозеландских пляжей. И что, его привезли из Новой Зеландии в Преторию? Точно. Видите ли, в семьях дипломатов это обычное дело. Кто-то другой оплачивает перевоз всего имущества, так что выбрасывать ничего не нужно, а нужно только приказать: "Пакуйте!" И тогда все упаковывается, и каждый раз при переезде в другую страну к предыдущему багажу добавляется новый контейнер. Так было и с этим мешком ракушек, который был упакован в дощатый ящик. Однажды я открыл его и начал их классифицировать и, не успев опомниться, составил приличную коллекцию ракушек. Тогда я впервые познакомился с бинарной номенклатурой Линнея. Ко времени поступления в университет я не сомневался в своем предназначении: стать величайшим в мире специалистом по африканским улиткам. Улитки... Да, в особенности, гигантские африканские улитки. Окончательное воплощение своей судьбы мне виделось в том, чтобы написать много-много томов монографического исследования по всем наземным моллюскам Африки. Поэтому всякий, кто захотел бы заняться наземными моллюсками в ближайшую сотню лет, должен был бы свериться с тем, что сделано Леруа. Сколько же вам было лет, когда вы строили эти планы? Семнадцать или что-то в этом роде. Но потом я поступил в университет. И хотя малакология казалась неплохим занятием, от переднего края науки она была далека. Меня заинтересовали абстрактные вопросы эволюционного процесса. Ко времени окончания университета и поступления в аспирантуру ракушки отправились обратно в ящик. Они и до сих пор со мной. Что вы изучаете в настоящее время? Я работаю в области науки, называемой эволюционной биологией развития, или "эво-дево". Специалисты в этой области хотят понять молекулярные основы эволюционных изменений. Мы стремимся узнать, какие гены ответственны, к примеру, за эволюцию конечностей: что позволило плавнику рыбы превратиться в мышиную лапку или куриное крылышко. После такого объяснения могу сообщить, что работаю с червями. А у них конечностей вовсе нет. С червями? Да. С таким малюсеньким червячком – С. elegans. Это очень и очень важный червяк: трое ребят заработали на нем Нобелевскую премию несколько лет назад. Я всегда об этом говорю, потому что людям кажется странным, что я работаю с червями, а мне хочется подчеркнуть, что это очень важные черви, необходимые для всех биологических исследований. Итак, да, вот этим я до сих пор и занимаюсь. Работаю в основном с червями. Как возникла идея этой книги? Специалисты в области биологии развития судят о том, как устроен организм животного, по мутантам. Это довольно-таки рутинная вещь. Я изучаю гигантских червей-мутантов и карликовых червей-мутантов. У меня вся лаборатория ими кишит. Конечно, если обычный червь величиной 1,2 миллиметра, то гигантский – около 2 миллиметров, так что все относительно. Как бы то ни было, в конце 1990-х годов произошел прорыв в генетике человека. Раньше в течение долгого времени педиатры и генетики занимались в основном классификацией наследственных заболеваний. Теперь, после секвенирования генома человека, появилась возможность идентифицировать мутантные гены, вызывающие заболевания. Мы впервые можем использовать мутантов для того, чтобы понять, как устроены люди, подобно тому, как это делается с червями. Мы можем рассказывать истории о конструировании человеческого тела. Вот когда я понял, что все эти истории могут составить книгу. Сколько на нее ушло времени? Невероятно много. Конечно, я при этом днем работал. Я подписал договор в начале 1999 года, так что в целом пять лет. И когда же вы писали? По вечерам и летом. Один сезон я провел в Греции, отсиживался на Лесбосе. Это была отличная идея, только я не так уж и много написал. Так или иначе, время шло, издатели злились, окончательные сроки приближались и отодвигались, покуда не настал самый распоследний срок представления рукописи, и... книга была закончена. Вам это трудно далось – так перестроить свою жизнь, чтобы выкраивать время для написания книги? Да, я потратил довольно много времени, чтобы обрести свой голос, чтобы научиться писать. Я думаю, что теперь смог бы написать ее гораздо быстрее и лучше. По крайней мере, так мне кажется. И что вы чувствовали, когда кончили писать? О, это было невыразимо приятно. Оглядываясь назад, я понимаю, что все проволочки и то время, которое я на нее потратил, не пропало зря, а помогло ее улучшить. Я бесконечно манипулировал с текстом, писал и переписывал заново, и в некоторой степени это отражено в книге. Она теперь более похожа на литературное произведение. Как вы считаете: ваш стиль выработался в процессе общения со студентами, когда вы старались донести до них те или иные идеи, или в процессе самого написания книги, которое заняло у вас столько времени? Как вам удалось сделать его таким литературным? Несомненно, справедливо то, что преподавание накладывает определенные обязательства в том смысле, что вы стараетесь объяснить материал с максимально возможной простотой, убедительностью и доходчивостью. Но следует сказать, что специфика письменного изложения отличается от устного преподавания. Написание книги требует определенного нарративного напряжения, которое не нужно для урока. И, конечно, в книгу можно включить культурные ассоциации, выходящие за рамки непосредственной тематики; именно это и делает сочинительство столь привлекательным занятием, доставляющим массу удовольствия. Преподавание современной биологии не позволяет этого делать; нужно четко отграничить свою территорию: при таком обилии научного материала, который необходимо изложить, практически не остается места для отступлений в сторону, культурных реминисценций об истории и иконографии циклопии. Студенты также теряют терпение и требуют фактов. В процессе создания текста испытывали ли вы на себе чье-то влияние? Есть ли какие-нибудь авторы, которыми бы вы восхищались? У меня есть любимые литературные мэтры. Я с энтузиазмом отношусь к В.Г. Зебальду и Брюсу Чатвину. Среди научно-популярных авторов я особенно выделяю Стива Джоунса. Думаю, "Язык генов" – это шедевр. Я прочитал книгу от корки до корки: она остроумна, не содержит ничего лишнего, насыщена информацией и, в смысле ясности изложенных идей и результатов, находится на недосягаемой высоте. В своей книге я в значительной степени равнялся на нее. Мой текст неизбежно иной – не такой блестящий, но это то, чего я хотел добиться. Что еще вы написали? Я кое-что писал для "Лондонского книжного обозрения" (London Review of Books) и, конечно, много научных статей. Что вы почувствовали, когда получили первую премию газеты "Гардиан"? Я был очень польщен. Что вы читаете "подпольно", для удовольствия? Романы Патрика О'Брайана. Я нахожу фигуру Стивена Мэтьюрина очень интересной – он натуралист и исключительно хороший сравнительный анатом, которому не чужды романтизм и эстетическое чувство. Довольно-таки сильный персонаж. Как вы пишете? Я всюду ношу с собой записную книжку. И потом я люблю поиграть с текстом, поэтому я делаю распечатки, смотрю на них, держа в руках ручку, добавляю одно предложение и снова распечатываю. Весьма много времени у меня уходит на созерцание распечаток. [о книге] Что я читал во время работы над книгой Я начал писать "Мутантов" в январе 1999 года. Книга появилась (в США) в ноябре 2003-го. Отсюда можно заключить, что поскольку она не слишком длинная, писать ее мне было нелегко. До того я написал много научных статей по генетике. Однако это мне не особенно помогло. Научная литература, конечно же, отличается собственной строгой красотой, но при этом она пишется по шаблону, что в действительности является ее достоинством. Когда я сел за "Мутантов", у меня была идея, контракт и аванс. Но я не знал, какую именно книгу хочу написать и как это можно сделать. Однако я прекрасно знал, какую книгу мне не хочется писать. Начиная с 1980-х годов вышло в свет большое количество научно-популярных книг, которые написаны не учеными, а журналистами. Многие из них превосходны. В других сплошь и рядом встречаются неудобоваримые тексты: Погода была ветреной, когда я взбирался по массивным ступеням Рокфеллеровского института. Я искал первого в мире специалиста по [вставьте сюда название какой-нибудь ужасной болезни]. Д-р Пол Вайнстин оказался на удивление молодым. На его майке была надпись "Рожденные клонировать", а ездил он на "порше". Глядя на меня своими ясными голубыми глазами, он сказал – и голос его дрогнул от усталости: "Если мы найдем этот ген, то сможем вылечить сотни детишек". Этот стиль проник даже в книги, написанные учеными. Конечно, ученые редко станут героизировать своих коллег. Вместо этого они сами предстают героями. Я виню покойного Стивена Джея Гульда за то, что с него началась вся эта чепуха. Я был преисполнен решимости сделать все иначе. В моей книге не будет восхищенных слов в адрес школьных учителей биологии; красочных описаний экзотических мест; рассказов о собственных научных успехах (к слову сказать, довольно скромных) или шуточек о личном опыте борьбы с физическими недостатками (я лысый, но от этого ничуть не страдаю. Правда!). Мое намерение держать дистанцию и говорить с читателем сдержанным авторским голосом было, между прочим, без восторга встречено литературными агентами и издателями. Читатели, утверждали они, хотят знать, кто такой автор; расскажите им, настаивали они, о себе; вам необходимо сильное "авторское присутствие". Может и так. Но моя жизнь была и осталась довольно-таки традиционной. Читатели, подумал я, должны испытывать незаурядный интерес к обыденному, чтобы найти в моей жизни хоть что-то занимательное. Если они жаждут банальностей вперемежку с наукой, пусть читают Билла Брайсона. Некоторые авторы ничего не читают, когда пишут. Или, по крайней мере, не читают книги того же жанра, что и пишут. Они боятся, что их сочинение будет заражено присутствием другого голоса. Я этого не боюсь. Столкнувшись с проблемой, как мне писать, я выбрал очевидное решение: пошел, как всегда, в библиотеку. Я разыскал книги, которые мне хотелось бы написать самому, собрал их вместе и поместил на отдельную полку, вне зависимости от предмета. Вот неполный список этих книг: Элейн Скерри. О красоте и справедливости (Elaine Scarry. On Beauty and Being Just, 2002) Джеймс Дэвидсон. Куртизанки и рыбные котлеты (James Davidson. Courtesans and Fishcakes, 1998) В.Г. Зебальд. Кольца Сатурна (W.G. Sebald. The Rings of Saturn, 1998) Стив Джоунс. Язык генов (Steve Jones. The Language of the Genes, 1993) Ноэль Аннан. Наш век (Noel Annan. Our Age, 1990) Брюс Чатвин. Что я здесь делаю (Bruce Chatwin. What Am I Doing Here, 1989) Питер Леви. Гора Кроноса (Peter Levi. The Hill of Kronos, 1980) Сирил Конноли. Враги обещаний (Cyril Connoly. Enemies of Promise, 1945) Уолтер Патер. Ренессанс (Walter Pater. The Renaissance, 1873). Стендаль. О любви Если дело не клеилось или мне не хватало ясности, или просто надоедала моя собственная писанина, я брал одну из книг и начинал листать ее в поисках вдохновения. Какие-то пассажи я прочел, должно быть, десятки раз. Что же я искал в них? В некоторых – решение технических проблем; у Аннана – умение кратко описывать бурную историю событий; у Зебальда – искусство писать длинными предложениями; у Скерри – как говорить, а вернее думать, о красоте; у Дэвидсона – как закончить книгу. У других я учился более абстрактным качествам: у Чатвина и Патера – сжатости и красоте звучания прозы; у Джоунса и Коннолли – остроумию; у Леви – гуманности и эрудиции; у Стендаля я хотел научиться искренности. Все эти писатели